Homologs in group_1825

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13520 FBDBKF_13520 53.7 Morganella morganii S1 arsC ArsC family reductase
EHELCC_08575 EHELCC_08575 53.7 Morganella morganii S2 arsC ArsC family reductase
NLDBIP_08900 NLDBIP_08900 53.7 Morganella morganii S4 arsC ArsC family reductase
LHKJJB_05365 LHKJJB_05365 53.7 Morganella morganii S3 arsC ArsC family reductase
HKOGLL_05550 HKOGLL_05550 53.7 Morganella morganii S5 arsC ArsC family reductase
F4V73_RS03240 F4V73_RS03240 57.4 Morganella psychrotolerans - ArsC family reductase

Distribution of the homologs in the orthogroup group_1825

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1825

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P24178 3.52e-39 130 54 0 112 1 yffB Protein YffB Escherichia coli (strain K12)
P44515 3.93e-30 107 46 2 109 1 HI_0103 Uncharacterized protein HI_0103 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q81GK7 5.85e-09 53 28 5 118 3 spx1 Global transcriptional regulator Spx 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81TR6 5.85e-09 53 28 5 118 3 spx1 Global transcriptional regulator Spx 1 Bacillus anthracis
Q8DPA8 1.63e-07 49 25 5 116 3 spx Global transcriptional regulator Spx Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97Q26 1.63e-07 49 25 5 116 3 spx Global transcriptional regulator Spx Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P54503 3.61e-07 48 27 6 119 1 mgsR Regulatory protein MgsR Bacillus subtilis (strain 168)
Q830U3 4.55e-07 48 26 6 116 3 spx Global transcriptional regulator Spx Enterococcus faecalis (strain ATCC 700802 / V583)
P0CZ83 5.33e-07 48 27 5 116 3 spx Global transcriptional regulator Spx Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ82 5.33e-07 48 27 5 116 3 spx Global transcriptional regulator Spx Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P60382 5.8e-07 48 27 5 116 3 spx Global transcriptional regulator Spx Streptococcus pyogenes serotype M18 (strain MGAS8232)
P60381 5.8e-07 48 27 5 116 3 spx Global transcriptional regulator Spx Streptococcus pyogenes serotype M1
P60376 1.14e-06 47 25 3 114 3 spx Global transcriptional regulator Spx Lactococcus lactis subsp. cremoris (strain MG1363)
P60375 1.14e-06 47 25 3 114 3 spx2 Global transcriptional regulator Spx 2 Lactococcus lactis subsp. lactis (strain IL1403)
Q9CI20 1.19e-06 47 25 4 114 3 spx1 Global transcriptional regulator Spx 1 Lactococcus lactis subsp. lactis (strain IL1403)
Q8CT68 1.56e-06 47 27 7 118 3 spx Global transcriptional regulator Spx Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQH3 1.56e-06 47 27 7 118 3 spx Global transcriptional regulator Spx Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4L505 2.02e-06 47 27 7 118 3 spx Global transcriptional regulator Spx Staphylococcus haemolyticus (strain JCSC1435)
Q9RGX0 3.2e-06 46 26 6 117 3 spx Global transcriptional regulator Spx Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71XH4 3.2e-06 46 26 6 117 3 spx Global transcriptional regulator Spx Listeria monocytogenes serotype 4b (strain F2365)
P60377 3.2e-06 46 26 6 117 3 spx Global transcriptional regulator Spx Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
O31602 5.87e-06 45 25 5 116 1 spx Global transcriptional regulator Spx Bacillus subtilis (strain 168)
Q49WC6 6.79e-06 45 26 7 118 3 spx Global transcriptional regulator Spx Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P60380 9e-06 45 26 7 118 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain MW2)
Q6GAS9 9e-06 45 26 7 118 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain MSSA476)
Q6GI88 9e-06 45 26 7 118 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain MRSA252)
P60379 9e-06 45 26 7 118 1 spx Global transcriptional regulator Spx Staphylococcus aureus (strain N315)
P60378 9e-06 45 26 7 118 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HH87 9e-06 45 26 7 118 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain COL)
Q2G1U6 9e-06 45 26 7 118 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q81MW4 2.25e-05 44 26 5 119 3 spx2 Global transcriptional regulator Spx 2 Bacillus anthracis
Q81AZ5 2.92e-05 43 26 5 119 3 spx2 Global transcriptional regulator Spx 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
O32175 3.14e-05 43 27 3 117 3 yusI Uncharacterized protein YusI Bacillus subtilis (strain 168)
Q8ERT7 0.00017 42 25 7 124 3 spx1 Global transcriptional regulator Spx 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07570
Feature type CDS
Gene -
Product ArsC family reductase
Location 1653627 - 1653998 (strand: 1)
Length 372 (nucleotides) / 123 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1825
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03960 ArsC family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1393 Inorganic ion transport and metabolism (P) P Arsenate reductase or related protein, glutaredoxin family

Protein Sequence

MSTTNLTYTMYGIKNCDTIKKARKWLDDNHIPYVFHDYRKDGLKEALLLTFTENLDWQTLVNKRGTTWRQLSDEEKNAITDVNAAIALMLDKPAIIKRPILVSSDNRFMVGFNANDYLTFTGA

Flanking regions ( +/- flanking 50bp)

CTTATACGTATTGATACCAATATTACGTATTGTCATATAAGGAAAATATCATGTCTACTACTAACCTGACATACACGATGTACGGCATAAAAAATTGCGATACAATCAAAAAAGCACGTAAATGGCTAGATGATAATCATATTCCTTATGTTTTTCATGATTACCGTAAAGACGGTTTGAAGGAAGCATTATTACTCACCTTTACAGAAAATTTAGATTGGCAGACATTGGTGAACAAAAGAGGAACAACTTGGCGTCAATTATCTGATGAAGAAAAAAATGCTATCACTGATGTGAATGCAGCCATTGCACTTATGCTTGATAAACCTGCCATTATTAAACGTCCAATTTTAGTCTCTTCTGATAATCGTTTTATGGTAGGTTTTAATGCTAATGATTACCTGACTTTTACAGGAGCCTAATTTTTATGTCCTGCCCTGTTATTGAACTTGCACAACAACTTATTTCTCGA