Homologs in group_1863

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13520 FBDBKF_13520 100.0 Morganella morganii S1 arsC ArsC family reductase
EHELCC_08575 EHELCC_08575 100.0 Morganella morganii S2 arsC ArsC family reductase
NLDBIP_08900 NLDBIP_08900 100.0 Morganella morganii S4 arsC ArsC family reductase
HKOGLL_05550 HKOGLL_05550 100.0 Morganella morganii S5 arsC ArsC family reductase
F4V73_RS03240 F4V73_RS03240 83.6 Morganella psychrotolerans - ArsC family reductase
PMI_RS07570 PMI_RS07570 53.7 Proteus mirabilis HI4320 - ArsC family reductase

Distribution of the homologs in the orthogroup group_1863

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1863

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P24178 2.26e-43 141 57 0 112 1 yffB Protein YffB Escherichia coli (strain K12)
P44515 1.32e-30 108 43 2 113 1 HI_0103 Uncharacterized protein HI_0103 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8DZV0 1.29e-09 55 26 5 117 3 spx Global transcriptional regulator Spx Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E5J8 1.29e-09 55 26 5 117 3 spx Global transcriptional regulator Spx Streptococcus agalactiae serotype III (strain NEM316)
Q9K8Z1 9.86e-09 53 26 5 109 3 spx Global transcriptional regulator Spx Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8DU17 2.7e-08 52 26 5 114 1 spx Global transcriptional regulator Spx Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P0CZ83 3.58e-08 51 26 5 116 3 spx Global transcriptional regulator Spx Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ82 3.58e-08 51 26 5 116 3 spx Global transcriptional regulator Spx Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P60382 3.86e-08 51 26 5 116 3 spx Global transcriptional regulator Spx Streptococcus pyogenes serotype M18 (strain MGAS8232)
P60381 3.86e-08 51 26 5 116 3 spx Global transcriptional regulator Spx Streptococcus pyogenes serotype M1
Q9RGX0 6.19e-08 50 23 4 114 3 spx Global transcriptional regulator Spx Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71XH4 6.19e-08 50 23 4 114 3 spx Global transcriptional regulator Spx Listeria monocytogenes serotype 4b (strain F2365)
P60377 6.19e-08 50 23 4 114 3 spx Global transcriptional regulator Spx Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P60376 9.91e-08 50 24 3 114 3 spx Global transcriptional regulator Spx Lactococcus lactis subsp. cremoris (strain MG1363)
P60375 9.91e-08 50 24 3 114 3 spx2 Global transcriptional regulator Spx 2 Lactococcus lactis subsp. lactis (strain IL1403)
O31602 1.12e-07 50 21 3 114 1 spx Global transcriptional regulator Spx Bacillus subtilis (strain 168)
Q8ERE2 1.68e-07 50 28 5 114 3 spx2 Global transcriptional regulator Spx 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q5XBX9 2.93e-07 49 25 5 116 3 spx Global transcriptional regulator Spx Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P54503 3.39e-07 48 30 4 96 1 mgsR Regulatory protein MgsR Bacillus subtilis (strain 168)
Q830U3 3.57e-07 48 23 4 115 3 spx Global transcriptional regulator Spx Enterococcus faecalis (strain ATCC 700802 / V583)
O32175 3.94e-06 45 28 4 107 3 yusI Uncharacterized protein YusI Bacillus subtilis (strain 168)
Q81AZ5 5.39e-06 45 21 4 115 3 spx2 Global transcriptional regulator Spx 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8ERT7 5.8e-06 45 21 4 114 3 spx1 Global transcriptional regulator Spx 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q81MW4 6.17e-06 45 21 3 114 3 spx2 Global transcriptional regulator Spx 2 Bacillus anthracis
Q8DPA8 7.37e-06 45 22 5 118 3 spx Global transcriptional regulator Spx Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97Q26 7.37e-06 45 22 5 118 3 spx Global transcriptional regulator Spx Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q5WEZ7 1.08e-05 45 22 4 109 3 spx Global transcriptional regulator Spx Shouchella clausii (strain KSM-K16)
Q8CT68 1.46e-05 44 21 4 114 3 spx Global transcriptional regulator Spx Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQH3 1.46e-05 44 21 4 114 3 spx Global transcriptional regulator Spx Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q81GK7 1.84e-05 44 19 3 114 3 spx1 Global transcriptional regulator Spx 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81TR6 1.84e-05 44 19 3 114 3 spx1 Global transcriptional regulator Spx 1 Bacillus anthracis
Q88V55 2.12e-05 44 19 3 114 3 spx Global transcriptional regulator Spx Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q49WC6 2.24e-05 44 21 4 114 3 spx Global transcriptional regulator Spx Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P60380 5.36e-05 43 20 4 114 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain MW2)
Q6GAS9 5.36e-05 43 20 4 114 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain MSSA476)
Q6GI88 5.36e-05 43 20 4 114 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain MRSA252)
P60379 5.36e-05 43 20 4 114 1 spx Global transcriptional regulator Spx Staphylococcus aureus (strain N315)
P60378 5.36e-05 43 20 4 114 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HH87 5.36e-05 43 20 4 114 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain COL)
Q2G1U6 5.36e-05 43 20 4 114 3 spx Global transcriptional regulator Spx Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q4L505 7.94e-05 42 20 4 114 3 spx Global transcriptional regulator Spx Staphylococcus haemolyticus (strain JCSC1435)
Q9CI20 9.16e-05 42 26 6 113 3 spx1 Global transcriptional regulator Spx 1 Lactococcus lactis subsp. lactis (strain IL1403)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_05365
Feature type CDS
Gene arsC
Product ArsC family reductase
Location 64076 - 64453 (strand: 1)
Length 378 (nucleotides) / 125 (amino acids)
In genomic island -

Contig

Accession ZDB_362
Length 257361 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1863
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03960 ArsC family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1393 Inorganic ion transport and metabolism (P) P Arsenate reductase or related protein, glutaredoxin family

Protein Sequence

MKNTTSVCRIFGIKNCDTMKKARAWLDAHQIAYEFHDYRQDGADTELLSEFARHIDWTQLLNKRGTTWRQLDKTEQDAVTDAQSAIRLMSEKPALIKRPVLISADGRYHLGFKADDYQQFFSLPA

Flanking regions ( +/- flanking 50bp)

TCAAATTCCCGCATTATGCTATTTTTCGTGTTCACGACAAAGGATAAAAGATGAAAAATACAACCTCCGTCTGCCGGATTTTCGGGATTAAAAACTGCGACACGATGAAAAAAGCCCGGGCATGGCTGGATGCTCATCAGATAGCGTATGAGTTTCATGATTACCGGCAGGATGGCGCGGATACAGAACTGCTCAGTGAATTTGCCCGTCATATTGACTGGACACAACTGCTCAACAAACGCGGCACCACCTGGCGTCAGCTGGATAAGACTGAACAGGATGCGGTGACAGATGCGCAGTCCGCCATCCGTCTGATGTCAGAAAAACCGGCGCTGATCAAACGTCCGGTGCTGATCTCTGCGGACGGCCGTTATCACCTTGGTTTTAAAGCTGATGATTATCAGCAGTTCTTCAGTCTTCCTGCCTGATACAGAGGAAACACCATGCATTGTCCTGTAACAGAACTGGCAAAACAGCT