Homologs in group_1825

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13520 FBDBKF_13520 83.6 Morganella morganii S1 arsC ArsC family reductase
EHELCC_08575 EHELCC_08575 83.6 Morganella morganii S2 arsC ArsC family reductase
NLDBIP_08900 NLDBIP_08900 83.6 Morganella morganii S4 arsC ArsC family reductase
LHKJJB_05365 LHKJJB_05365 83.6 Morganella morganii S3 arsC ArsC family reductase
HKOGLL_05550 HKOGLL_05550 83.6 Morganella morganii S5 arsC ArsC family reductase
PMI_RS07570 PMI_RS07570 57.4 Proteus mirabilis HI4320 - ArsC family reductase

Distribution of the homologs in the orthogroup group_1825

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1825

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P24178 2.38e-41 135 56 0 111 1 yffB Protein YffB Escherichia coli (strain K12)
P44515 2.15e-26 97 43 2 109 1 HI_0103 Uncharacterized protein HI_0103 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8DZV0 1.67e-07 50 23 3 113 3 spx Global transcriptional regulator Spx Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E5J8 1.67e-07 50 23 3 113 3 spx Global transcriptional regulator Spx Streptococcus agalactiae serotype III (strain NEM316)
Q8DU17 1.07e-06 47 21 3 113 1 spx Global transcriptional regulator Spx Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8ERE2 1.1e-06 47 26 5 114 3 spx2 Global transcriptional regulator Spx 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q81MW4 4.18e-06 46 21 3 113 3 spx2 Global transcriptional regulator Spx 2 Bacillus anthracis
Q9K8Z1 1.01e-05 45 20 3 108 3 spx Global transcriptional regulator Spx Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q88V55 1.43e-05 44 19 3 113 3 spx Global transcriptional regulator Spx Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q9RGX0 1.86e-05 44 21 4 113 3 spx Global transcriptional regulator Spx Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71XH4 1.86e-05 44 21 4 113 3 spx Global transcriptional regulator Spx Listeria monocytogenes serotype 4b (strain F2365)
P60377 1.86e-05 44 21 4 113 3 spx Global transcriptional regulator Spx Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
O31602 4.14e-05 43 19 3 113 1 spx Global transcriptional regulator Spx Bacillus subtilis (strain 168)
Q81GK7 4.89e-05 43 21 4 114 3 spx1 Global transcriptional regulator Spx 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81TR6 4.89e-05 43 21 4 114 3 spx1 Global transcriptional regulator Spx 1 Bacillus anthracis
Q8DPA8 0.00016 42 21 5 117 3 spx Global transcriptional regulator Spx Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97Q26 0.00016 42 21 5 117 3 spx Global transcriptional regulator Spx Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q81AZ5 0.000164 42 20 3 113 3 spx2 Global transcriptional regulator Spx 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q9CI20 0.000167 41 27 4 111 3 spx1 Global transcriptional regulator Spx 1 Lactococcus lactis subsp. lactis (strain IL1403)
Q8ERT7 0.000251 41 19 3 113 3 spx1 Global transcriptional regulator Spx 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P76569 0.000346 40 22 3 106 1 yfgD Uncharacterized protein YfgD Escherichia coli (strain K12)
Q830U3 0.000539 40 19 3 113 3 spx Global transcriptional regulator Spx Enterococcus faecalis (strain ATCC 700802 / V583)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03240
Feature type CDS
Gene -
Product ArsC family reductase
Location 691504 - 691872 (strand: -1)
Length 369 (nucleotides) / 122 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1825
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03960 ArsC family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1393 Inorganic ion transport and metabolism (P) P Arsenate reductase or related protein, glutaredoxin family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00537 arsenate reductase (glutaredoxin) [EC:1.20.4.1] - -

Protein Sequence

MKNTPSVYRIFGIKNCDTMKKARAWLDTNGIAYEFHDYRQDGIDAALLTEFIRHIDLTQLLNKRGTTWRQLDKTEQDAATDTAAAIRLMTEKPALIKRPVLVSPDGRYHLGFKADDYQQFCR

Flanking regions ( +/- flanking 50bp)

CCAAATTACCGCATTATGCTATTTTTCGTGTTCACGACAAAGGATTAAAGATGAAAAATACACCCTCCGTCTACCGGATTTTTGGTATCAAAAATTGCGACACGATGAAAAAAGCCCGCGCATGGCTGGATACAAACGGGATCGCATATGAATTCCACGACTACCGGCAGGATGGCATTGATGCCGCGCTGCTGACAGAATTTATCCGTCATATTGACCTGACACAACTGCTCAATAAACGCGGCACCACCTGGCGCCAGCTGGATAAAACAGAGCAGGATGCCGCGACTGATACCGCTGCTGCTATCCGTCTGATGACGGAAAAACCGGCCTTAATTAAACGCCCGGTGCTGGTTTCCCCGGACGGTCGCTACCACCTTGGTTTTAAAGCTGATGACTATCAGCAGTTCTGCCGCTGAATATCGCCATACCCTTATTCATTCAAACTGCAGGTTCGTTGGCGGCATGA