Homologs in group_3669

Help

3 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20470 FBDBKF_20470 24.3 Morganella morganii S1 - HTH tetR-type domain-containing protein
PMI_RS11865 PMI_RS11865 24.5 Proteus mirabilis HI4320 tetR(J) tetracycline resistance transcriptional repressor TetR(J)
PMI_RS15255 PMI_RS15255 21.4 Proteus mirabilis HI4320 - TetR/AcrR family transcriptional regulator C-terminal domain-containing protein

Distribution of the homologs in the orthogroup group_3669

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3669

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EX96 4.68e-149 414 100 0 200 3 betI HTH-type transcriptional regulator BetI Proteus mirabilis (strain HI4320)
Q6D6E1 1.72e-94 276 69 0 192 3 betI HTH-type transcriptional regulator BetI Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DKY6 3.21e-94 275 69 0 192 3 betI HTH-type transcriptional regulator BetI Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A8GBX7 9e-93 272 69 0 192 3 betI HTH-type transcriptional regulator BetI Serratia proteamaculans (strain 568)
Q66D52 2.34e-90 266 65 0 194 3 betI HTH-type transcriptional regulator BetI Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNP0 2.34e-90 266 65 0 194 3 betI HTH-type transcriptional regulator BetI Yersinia pestis (strain Pestoides F)
Q1CFR9 2.34e-90 266 65 0 194 3 betI HTH-type transcriptional regulator BetI Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZGV8 2.34e-90 266 65 0 194 3 betI HTH-type transcriptional regulator BetI Yersinia pestis
B2K8U6 2.34e-90 266 65 0 194 3 betI HTH-type transcriptional regulator BetI Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C930 2.34e-90 266 65 0 194 3 betI HTH-type transcriptional regulator BetI Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKL4 2.34e-90 266 65 0 194 3 betI HTH-type transcriptional regulator BetI Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4XPI7 5.6e-89 262 64 0 193 3 betI HTH-type transcriptional regulator BetI Pseudomonas mendocina (strain ymp)
Q3K5H5 2.34e-87 258 63 0 192 3 betI HTH-type transcriptional regulator BetI Pseudomonas fluorescens (strain Pf0-1)
Q4ZM61 9.89e-86 254 63 0 192 3 betI HTH-type transcriptional regulator BetI Pseudomonas syringae pv. syringae (strain B728a)
Q48CM5 9.89e-86 254 63 0 192 3 betI HTH-type transcriptional regulator BetI Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q88AF0 1.58e-85 253 63 0 192 3 betI HTH-type transcriptional regulator BetI Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4K4K9 7.09e-85 252 63 0 192 3 betI HTH-type transcriptional regulator BetI Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
C3K3D1 2.24e-84 251 63 0 192 3 betI HTH-type transcriptional regulator BetI Pseudomonas fluorescens (strain SBW25)
A7MFA6 1.31e-82 246 62 0 192 3 betI HTH-type transcriptional regulator BetI Cronobacter sakazakii (strain ATCC BAA-894)
B5Y006 4.27e-80 239 63 0 192 3 betI HTH-type transcriptional regulator BetI Klebsiella pneumoniae (strain 342)
Q0TKV9 6.84e-80 239 63 0 193 3 betI HTH-type transcriptional regulator BetI Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7N8L5 7.63e-80 239 63 0 192 3 betI HTH-type transcriptional regulator BetI Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NK49 8.05e-80 239 63 0 192 3 betI HTH-type transcriptional regulator BetI Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P17446 1.22e-79 238 63 0 192 2 betI HTH-type transcriptional regulator BetI Escherichia coli (strain K12)
B1J0W4 1.22e-79 238 63 0 192 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XET8 1.22e-79 238 63 0 192 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain K12 / DH10B)
B6I093 5.96e-79 237 63 0 192 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain SE11)
B7M2V7 5.96e-79 237 63 0 192 3 betI HTH-type transcriptional regulator BetI Escherichia coli O8 (strain IAI1)
B1LIJ9 8.84e-79 236 63 0 192 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain SMS-3-5 / SECEC)
Q8FKI7 1.12e-78 236 63 0 192 3 betI HTH-type transcriptional regulator BetI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7UJG6 1.12e-78 236 63 0 192 3 betI HTH-type transcriptional regulator BetI Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q0T7M8 1.3e-78 236 63 0 192 3 betI HTH-type transcriptional regulator BetI Shigella flexneri serotype 5b (strain 8401)
A7ZWV6 1.3e-78 236 63 0 192 3 betI HTH-type transcriptional regulator BetI Escherichia coli O9:H4 (strain HS)
B7L442 1.3e-78 236 63 0 192 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain 55989 / EAEC)
A7ZI52 1.3e-78 236 63 0 192 3 betI HTH-type transcriptional regulator BetI Escherichia coli O139:H28 (strain E24377A / ETEC)
B5Z1R2 1.37e-78 236 63 0 192 3 betI HTH-type transcriptional regulator BetI Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X6C3 1.37e-78 236 63 0 192 3 betI HTH-type transcriptional regulator BetI Escherichia coli O157:H7
Q1RFM1 3.43e-78 235 63 0 192 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain UTI89 / UPEC)
B7MCD2 3.43e-78 235 63 0 192 3 betI HTH-type transcriptional regulator BetI Escherichia coli O45:K1 (strain S88 / ExPEC)
Q9HTJ0 4.29e-77 232 65 0 192 3 betI HTH-type transcriptional regulator BetI Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DY8 4.29e-77 232 65 0 192 3 betI HTH-type transcriptional regulator BetI Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V5R5 4.29e-77 232 65 0 192 3 betI HTH-type transcriptional regulator BetI Pseudomonas aeruginosa (strain LESB58)
A6VEI5 4.29e-77 232 65 0 192 3 betI HTH-type transcriptional regulator BetI Pseudomonas aeruginosa (strain PA7)
Q9L4K2 1.03e-76 231 58 0 193 3 betI2 HTH-type transcriptional regulator BetI 2 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1QXD9 1.84e-76 231 58 1 192 3 betI1 HTH-type transcriptional regulator BetI 1 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B2JS87 2.29e-73 223 55 1 192 3 betI HTH-type transcriptional regulator BetI Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q2T6C8 8.94e-71 216 55 1 192 3 betI HTH-type transcriptional regulator BetI Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A4JJG4 1.37e-70 216 54 1 192 3 betI HTH-type transcriptional regulator BetI Burkholderia vietnamiensis (strain G4 / LMG 22486)
B4EHJ0 3.21e-70 214 53 1 192 3 betI HTH-type transcriptional regulator BetI Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q63KK9 8.68e-70 213 54 1 192 3 betI HTH-type transcriptional regulator BetI Burkholderia pseudomallei (strain K96243)
A3NKP7 8.68e-70 213 54 1 192 3 betI HTH-type transcriptional regulator BetI Burkholderia pseudomallei (strain 668)
Q3JLL9 8.68e-70 213 54 1 192 3 betI HTH-type transcriptional regulator BetI Burkholderia pseudomallei (strain 1710b)
A3P6A9 8.68e-70 213 54 1 192 3 betI HTH-type transcriptional regulator BetI Burkholderia pseudomallei (strain 1106a)
A2RWD7 8.68e-70 213 54 1 192 3 betI HTH-type transcriptional regulator BetI Burkholderia mallei (strain NCTC 10229)
A3MEC5 8.68e-70 213 54 1 192 3 betI HTH-type transcriptional regulator BetI Burkholderia mallei (strain NCTC 10247)
Q39A42 1.64e-69 213 54 1 192 3 betI HTH-type transcriptional regulator BetI Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1BQE0 3.22e-69 212 53 1 192 3 betI HTH-type transcriptional regulator BetI Burkholderia orbicola (strain AU 1054)
B1K709 3.22e-69 212 53 1 192 3 betI HTH-type transcriptional regulator BetI Burkholderia orbicola (strain MC0-3)
A0B2F5 3.22e-69 212 53 1 192 3 betI HTH-type transcriptional regulator BetI Burkholderia cenocepacia (strain HI2424)
Q62CH6 4.62e-69 212 54 1 192 3 betI HTH-type transcriptional regulator BetI Burkholderia mallei (strain ATCC 23344)
Q0B713 1.17e-68 211 54 1 192 3 betI HTH-type transcriptional regulator BetI Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1Z032 1.17e-68 211 54 1 192 3 betI HTH-type transcriptional regulator BetI Burkholderia ambifaria (strain MC40-6)
A9AN01 1.23e-66 206 53 1 192 3 betI HTH-type transcriptional regulator BetI Burkholderia multivorans (strain ATCC 17616 / 249)
B4SHW1 2.46e-66 205 55 1 192 3 betI HTH-type transcriptional regulator BetI Stenotrophomonas maltophilia (strain R551-3)
B2TCK0 5.36e-63 196 54 1 192 3 betI HTH-type transcriptional regulator BetI Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B7VQ27 5.27e-62 194 49 1 198 3 betI HTH-type transcriptional regulator BetI Vibrio atlanticus (strain LGP32)
Q13NG5 3.78e-61 192 54 1 192 3 betI HTH-type transcriptional regulator BetI Paraburkholderia xenovorans (strain LB400)
Q87H51 9.3e-61 191 48 0 198 3 betI HTH-type transcriptional regulator BetI Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7N212 2.85e-59 187 48 0 194 3 betI HTH-type transcriptional regulator BetI Vibrio campbellii (strain ATCC BAA-1116)
Q8D3K4 1.4e-58 185 47 0 194 3 betI HTH-type transcriptional regulator BetI Vibrio vulnificus (strain CMCP6)
Q7MF14 7.2e-58 183 47 0 194 3 betI HTH-type transcriptional regulator BetI Vibrio vulnificus (strain YJ016)
A6X2G6 1.18e-36 129 35 1 192 3 betI HTH-type transcriptional regulator BetI Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q57EH9 5.48e-36 127 35 1 193 3 betI HTH-type transcriptional regulator BetI Brucella abortus biovar 1 (strain 9-941)
Q2YMS6 5.48e-36 127 35 1 193 3 betI HTH-type transcriptional regulator BetI Brucella abortus (strain 2308)
Q8YFY3 1.5e-35 126 34 1 193 3 betI HTH-type transcriptional regulator BetI Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RHQ4 1.5e-35 126 34 1 193 3 betI HTH-type transcriptional regulator BetI Brucella melitensis biotype 2 (strain ATCC 23457)
Q8G1Z7 1.94e-35 126 34 1 193 3 betI HTH-type transcriptional regulator BetI Brucella suis biovar 1 (strain 1330)
B0CKN5 2.95e-35 125 35 1 193 3 betI HTH-type transcriptional regulator BetI Brucella suis (strain ATCC 23445 / NCTC 10510)
A9M9H9 3.6e-34 123 34 1 193 3 betI HTH-type transcriptional regulator BetI Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q985M2 1.11e-32 119 37 1 193 3 betI HTH-type transcriptional regulator BetI Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8UH57 1.01e-30 114 37 2 200 3 betI HTH-type transcriptional regulator BetI Agrobacterium fabrum (strain C58 / ATCC 33970)
O69786 8.15e-29 109 32 3 205 3 betI HTH-type transcriptional regulator BetI Rhizobium meliloti (strain 1021)
O34381 4.39e-11 62 30 5 179 4 pksA HTH-type transcriptional regulator PksA Bacillus subtilis (strain 168)
O07001 6.26e-05 45 40 1 59 1 yvdT Uncharacterized HTH-type transcriptional regulator YvdT Bacillus subtilis (strain 168)
Q7VN48 0.00051 42 33 2 69 3 slmA Nucleoid occlusion factor SlmA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8ZR43 0.000579 42 35 2 80 1 ramR Transcriptional regulator RamR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B0BTZ2 0.000791 42 33 2 69 3 slmA Nucleoid occlusion factor SlmA Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H337 0.000791 42 33 2 69 3 slmA Nucleoid occlusion factor SlmA Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N3Q5 0.000791 42 33 2 69 3 slmA Nucleoid occlusion factor SlmA Actinobacillus pleuropneumoniae serotype 5b (strain L20)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07070
Feature type CDS
Gene betI
Product transcriptional regulator BetI
Location 1542890 - 1543492 (strand: -1)
Length 603 (nucleotides) / 200 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3669
Orthogroup size 4
N. genomes 2

Actions

Genomic region

Domains

PF00440 Bacterial regulatory proteins, tetR family
PF13977 BetI-type transcriptional repressor, C-terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3226 Transcription (K) K DNA-binding transcriptional regulator YbjK

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02167 TetR/AcrR family transcriptional regulator, transcriptional repressor of bet genes - -

Protein Sequence

MPKIGMQSIRKQQLIQATLAVINEVGMQDASIALIARKAGVSNGIISHYFRDKNGLLEAAMRHIQYQLGFAVAMRLRILSDAEPKLRIQAIVDGNFDTSQTSETAMKTWLAFWASSMHQPNLHRLQKVNDRRLYSNLCYEFGRALTKDKARLAAKGLAALIDGLWLRSALSEEPFSLAEAKKITDEYIDMQLNLCQDKQT

Flanking regions ( +/- flanking 50bp)

AAAAAAACGTTTAATAAAAGTGTTCAATGTATTTTTTAGGTCTTGAAAACATGCCGAAGATAGGGATGCAGTCGATACGTAAACAGCAATTAATTCAGGCGACATTAGCGGTGATTAATGAGGTCGGAATGCAAGATGCCAGCATTGCATTAATTGCACGAAAGGCCGGGGTATCTAATGGCATTATAAGCCACTACTTCCGTGATAAAAATGGTTTATTGGAAGCGGCAATGCGCCATATCCAATATCAGTTAGGTTTTGCCGTCGCAATGCGATTACGTATTTTAAGCGATGCTGAGCCTAAATTGCGTATTCAAGCCATTGTCGATGGTAACTTTGATACGTCACAAACCAGTGAAACCGCAATGAAAACTTGGCTGGCTTTTTGGGCAAGTAGCATGCATCAGCCTAATTTGCATCGTTTACAAAAGGTTAATGATAGACGTTTGTACTCTAATCTCTGTTATGAATTTGGACGTGCGTTAACAAAAGATAAAGCACGCTTAGCCGCCAAAGGCTTGGCCGCTTTAATCGATGGTTTATGGCTACGTAGTGCCCTTAGCGAGGAGCCATTTTCGTTAGCAGAAGCAAAAAAAATTACTGATGAGTATATCGATATGCAACTTAATCTTTGCCAGGATAAACAGACTTAACTTACTCACTATAAAGGAGAAAATATGCAAAACCCACCGTTACACAAGCT