Homologs in group_2583

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02875 FBDBKF_02875 100.0 Morganella morganii S1 tetR TetR family transcriptional regulator
EHELCC_03345 EHELCC_03345 100.0 Morganella morganii S2 tetR TetR family transcriptional regulator
NLDBIP_00115 NLDBIP_00115 100.0 Morganella morganii S4 tetR TetR family transcriptional regulator
HKOGLL_01960 HKOGLL_01960 100.0 Morganella morganii S5 tetR TetR family transcriptional regulator
F4V73_RS05320 F4V73_RS05320 80.7 Morganella psychrotolerans - TetR/AcrR family transcriptional regulator

Distribution of the homologs in the orthogroup group_2583

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2583

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P03038 0.000579 42 35 2 94 1 tetR Tetracycline repressor protein class A from transposon 1721 Escherichia coli
P21337 0.000857 42 30 2 94 1 tetR Tetracycline repressor protein class E Escherichia coli
P51562 0.000898 42 28 2 125 2 tetR Tetracycline repressor protein class H Photobacterium damsela subsp. piscicida
P0ACT5 0.000898 42 28 2 125 3 tetR Tetracycline repressor protein class D Salmonella ordonez
P0ACT4 0.000898 42 28 2 125 1 tetR Tetracycline repressor protein class D Escherichia coli

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_01920
Feature type CDS
Gene tetR
Product TetR family transcriptional regulator
Location 370250 - 370828 (strand: 1)
Length 579 (nucleotides) / 192 (amino acids)

Contig

Accession ZDB_359
Length 392768 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2583
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00440 Bacterial regulatory proteins, tetR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1309 Transcription (K) K DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K18476 TetR/AcrR family transcriptional regulator, tetracycline repressor protein - -

Protein Sequence

MTSSRIPPCGRPAHRGSKLTAENILSEAGKLLQEQGKVPSIRVLAAQLQVDPMAIYYYFRNKQALLEALATALVDDIYQPSAQAPVQQELQRLAESYLHLLYIYSDLLDILLSLNSDGPSGCFRQRYLRIIAPCGLNESRQTAILHLLADALHGHTVAIRRTDYTFEQSRALFQPVLALITELIERPGASLS

Flanking regions ( +/- flanking 50bp)

CCGGTTTTATCCGTAAATACCGCCACCATTTCCGCTGACAGAGGCAACCTATGACATCATCCCGAATACCGCCCTGCGGACGCCCTGCTCACCGGGGCAGCAAACTGACCGCCGAAAATATTCTGTCCGAGGCCGGAAAACTGTTACAGGAACAGGGAAAAGTACCGTCGATCCGCGTCCTTGCCGCACAGTTGCAGGTCGATCCGATGGCGATTTATTATTACTTCCGCAATAAACAGGCATTGCTGGAAGCCCTCGCCACTGCCCTGGTGGATGATATTTATCAGCCCTCGGCACAGGCTCCGGTACAACAGGAGCTTCAGCGACTGGCAGAAAGTTATCTGCATCTGCTCTATATTTACAGTGATCTGCTGGATATTCTGTTATCACTGAACAGTGACGGCCCGTCCGGCTGTTTCCGTCAGCGCTATCTGCGCATTATTGCACCCTGCGGGCTGAATGAGTCACGGCAGACCGCTATTCTGCATCTGCTGGCGGATGCCCTGCACGGCCATACGGTGGCGATCCGCCGGACTGATTACACCTTTGAACAGAGCCGGGCGCTGTTTCAGCCGGTACTGGCATTAATTACCGAACTTATTGAACGCCCCGGAGCATCATTATCATGAATATCCGCCCTGTTACCGGTTTACCCGGCGATTTACCGCTGCTGGAAAGC