Homologs in group_1520

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09825 FBDBKF_09825 88.2 Morganella morganii S1 sdhB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit
EHELCC_04625 EHELCC_04625 88.2 Morganella morganii S2 sdhB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit
NLDBIP_04625 NLDBIP_04625 88.2 Morganella morganii S4 sdhB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit
LHKJJB_14005 LHKJJB_14005 88.2 Morganella morganii S3 sdhB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit
HKOGLL_12530 HKOGLL_12530 88.2 Morganella morganii S5 sdhB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit
F4V73_RS00520 F4V73_RS00520 88.7 Morganella psychrotolerans - succinate dehydrogenase iron-sulfur subunit

Distribution of the homologs in the orthogroup group_1520

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1520

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZQU2 4.66e-160 445 88 0 238 3 sdhB Succinate dehydrogenase iron-sulfur subunit Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P07014 1.87e-159 444 87 0 238 1 sdhB Succinate dehydrogenase iron-sulfur subunit Escherichia coli (strain K12)
P51053 3.19e-97 286 60 2 235 3 sdhB Succinate dehydrogenase iron-sulfur subunit Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q68XS0 5.02e-91 271 55 3 231 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q92JJ8 8.5e-90 268 55 3 231 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9ZEA1 1.15e-89 268 54 3 231 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia prowazekii (strain Madrid E)
Q8LB02 1.39e-89 268 56 5 232 1 SDH2-2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial Arabidopsis thaliana
Q4UN71 1.91e-89 267 55 3 231 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A5PL98 5.21e-89 267 55 5 236 2 sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Danio rerio
B0BM36 7.96e-89 266 56 6 237 2 sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Xenopus tropicalis
Q3B8J8 3.25e-88 265 57 6 234 2 sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Xenopus laevis
Q1RGP3 6.34e-88 263 54 3 231 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia bellii (strain RML369-C)
Q9CQA3 1.29e-87 263 56 6 237 1 Sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Mus musculus
P21912 3.36e-87 262 55 6 237 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Homo sapiens
Q70KF8 3.58e-87 262 56 6 230 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Uromyces fabae
P21913 6.25e-87 262 56 6 236 2 Sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Rattus norvegicus
Q007T0 7.37e-87 261 55 6 237 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Sus scrofa
Q75CI4 9.5e-87 260 54 4 231 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q3T189 1.03e-86 261 56 6 237 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Bos taurus
Q8LBZ7 1.82e-86 260 54 5 232 1 SDH2-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial Arabidopsis thaliana
O42772 6.25e-86 259 54 4 231 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Zymoseptoria tritici
Q9YHT2 8.35e-86 259 55 6 237 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Gallus gallus
P21914 5.78e-85 257 54 5 235 2 SdhB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Drosophila melanogaster
Q59662 7.98e-85 256 52 4 231 3 sdhB Succinate dehydrogenase iron-sulfur subunit Paracoccus denitrificans
P21911 1.01e-83 253 52 5 231 3 sdh2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P32420 1.42e-83 254 54 6 229 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Ustilago maydis (strain 521 / FGSC 9021)
O44074 9.09e-83 251 53 5 234 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Ascaris suum
Q09545 2.41e-82 251 53 6 234 2 sdhb-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Caenorhabditis elegans
P21801 3.25e-82 249 52 4 231 1 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A8WPF0 3.63e-82 249 52 6 234 3 sdhb-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Caenorhabditis briggsae
Q6FWS8 3.8e-82 248 52 4 231 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
P80480 6.57e-82 248 51 4 227 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Reclinomonas americana
Q9S827 2.46e-80 245 51 5 234 1 SDH2-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial Oryza sativa subsp. japonica
P48932 2.56e-78 239 51 4 231 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Chondrus crispus
Q9FJP9 1.4e-77 239 50 5 237 1 SDH2-3 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial Arabidopsis thaliana
Q55CC2 1.89e-76 235 50 6 238 3 sdhB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Dictyostelium discoideum
P48933 5.5e-75 231 49 3 229 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Cyanidium caldarium
P80477 6.95e-74 227 48 5 232 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Porphyra purpurea
Q6H4G3 2e-67 213 44 6 233 1 SDH2-2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial Oryza sativa subsp. japonica
P0AC50 5.82e-47 159 39 4 229 3 frdB Fumarate reductase iron-sulfur subunit Shigella flexneri
P0AC47 5.82e-47 159 39 4 229 1 frdB Fumarate reductase iron-sulfur subunit Escherichia coli (strain K12)
P0AC48 5.82e-47 159 39 4 229 3 frdB Fumarate reductase iron-sulfur subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AC49 5.82e-47 159 39 4 229 3 frdB Fumarate reductase iron-sulfur subunit Escherichia coli O157:H7
P9WN89 2.93e-46 157 35 6 239 1 frdB Fumarate reductase iron-sulfur subunit Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN88 2.93e-46 157 35 6 239 3 frdB Fumarate reductase iron-sulfur subunit Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P20921 4.6e-46 156 38 4 230 3 frdB Fumarate reductase iron-sulfur subunit Proteus vulgaris
P44893 2.94e-45 154 37 6 240 3 frdB Fumarate reductase iron-sulfur subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9ZMP1 6.02e-29 112 32 8 234 3 frdB Fumarate reductase iron-sulfur subunit Helicobacter pylori (strain J99 / ATCC 700824)
P17596 4.8e-28 109 30 8 237 1 frdB Fumarate reductase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
O06914 4.89e-28 109 32 8 234 3 frdB Fumarate reductase iron-sulfur subunit Helicobacter pylori (strain ATCC 700392 / 26695)
D9PUX5 9.28e-22 96 31 11 239 1 tfrB Fumarate reductase (CoM/CoB) subunit B Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q7M826 1.47e-21 94 28 3 219 1 sdhB 8-methylmenaquinol:fumarate reductase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q57557 1.48e-20 93 30 10 233 3 MJ0092 Uncharacterized iron-sulfur protein MJ0092 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P08066 2.8e-18 84 27 9 240 3 sdhB Succinate dehydrogenase iron-sulfur subunit Bacillus subtilis (strain 168)
Q6LYC4 7.59e-18 85 30 8 203 3 MMP1067 Uncharacterized iron-sulfur protein MMP1067 Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS02795
Feature type CDS
Gene -
Product succinate dehydrogenase iron-sulfur subunit
Location 612788 - 613504 (strand: 1)
Length 717 (nucleotides) / 238 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1520
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13085 2Fe-2S iron-sulfur cluster binding domain
PF13534 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0479 Energy production and conversion (C) C Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit

Kegg Ortholog Annotation(s)

Protein Sequence

MKLEFSIYRYNPDVDNAPRMQDYTLEVPEGRDMMLLDALIQLKEKDPTLSFRRSCREGVCGSDGVNMNGKNGLACITPISSLQKGSKKIVIRPLPGLPVIRDLIVDMTQFYTQYEKIRPYVINDDKNPPARENLQSPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETESRLDDLSDAFSVFRCHGIMNCVSVCPKGLNPTKAIGHIKSMLLKHSA

Flanking regions ( +/- flanking 50bp)

AGTGCGTACATATTAATTAGCGGTGTTATTGAAGTTGCGGAGACTGAATTATGAAACTTGAATTTTCAATTTATCGTTATAATCCCGACGTTGATAATGCGCCGCGTATGCAAGATTACACGCTTGAAGTACCCGAAGGGCGTGACATGATGTTGCTAGATGCATTAATTCAATTAAAGGAAAAAGATCCTACATTATCATTCCGTCGTTCTTGCCGTGAAGGTGTATGTGGCTCCGATGGAGTGAACATGAATGGTAAAAATGGTTTGGCATGTATCACACCTATTTCATCTTTACAGAAAGGAAGTAAGAAAATTGTGATCAGACCGTTACCAGGTCTACCGGTTATTCGTGATTTAATAGTGGATATGACTCAATTCTATACGCAGTACGAGAAGATCCGTCCATATGTGATTAACGACGACAAAAATCCTCCGGCTCGTGAGAATCTACAGTCACCAGAACAACGTGAAAAACTTGACGGACTTTATGAGTGTATTCTTTGTGCTTGTTGTTCAACATCTTGCCCGTCATTCTGGTGGAATCCAGATAAGTTTATTGGACCTGCTGGACTGTTAGCAGCGTATCGTTTCTTGATTGATAGTCGTGATACTGAAACAGAATCTCGTCTTGATGATTTAAGTGATGCGTTTAGTGTATTCCGTTGTCACGGTATTATGAACTGTGTCAGCGTATGTCCAAAAGGGTTAAATCCGACTAAAGCAATTGGTCATATTAAATCAATGTTGCTAAAACATAGTGCATAAATTAATAACCGCCCTAAAATAGTTAGGGCGGTTAATGAAAAAATTAAGTT