Homologs in group_1569

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09825 FBDBKF_09825 96.2 Morganella morganii S1 sdhB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit
EHELCC_04625 EHELCC_04625 96.2 Morganella morganii S2 sdhB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit
NLDBIP_04625 NLDBIP_04625 96.2 Morganella morganii S4 sdhB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit
LHKJJB_14005 LHKJJB_14005 96.2 Morganella morganii S3 sdhB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit
HKOGLL_12530 HKOGLL_12530 96.2 Morganella morganii S5 sdhB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit
PMI_RS02795 PMI_RS02795 88.7 Proteus mirabilis HI4320 - succinate dehydrogenase iron-sulfur subunit

Distribution of the homologs in the orthogroup group_1569

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1569

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZQU2 6.92e-159 442 85 0 238 3 sdhB Succinate dehydrogenase iron-sulfur subunit Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P07014 1.9e-157 439 84 0 238 1 sdhB Succinate dehydrogenase iron-sulfur subunit Escherichia coli (strain K12)
P51053 3.54e-96 283 59 2 233 3 sdhB Succinate dehydrogenase iron-sulfur subunit Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q9ZEA1 4.34e-93 276 56 3 234 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia prowazekii (strain Madrid E)
Q92JJ8 8.64e-93 276 56 3 234 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q4UN71 1.48e-92 275 56 3 234 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q68XS0 3.73e-92 274 55 3 234 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q1RGP3 7.28e-91 271 55 3 234 3 sdhB Succinate dehydrogenase iron-sulfur subunit Rickettsia bellii (strain RML369-C)
A5PL98 7.46e-89 266 55 5 234 2 sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Danio rerio
Q8LB02 1.23e-88 266 55 5 232 1 SDH2-2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial Arabidopsis thaliana
P21912 1.26e-88 266 55 5 233 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Homo sapiens
B0BM36 1.71e-88 266 56 5 233 2 sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Xenopus tropicalis
Q007T0 2.98e-88 265 55 5 233 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Sus scrofa
Q75CI4 4.93e-88 264 55 4 231 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q3B8J8 6.47e-88 264 56 5 233 2 sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Xenopus laevis
Q3T189 7.79e-88 264 55 5 233 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Bos taurus
P21914 1.2e-87 264 54 5 235 2 SdhB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Drosophila melanogaster
Q8LBZ7 2.06e-87 263 54 4 230 1 SDH2-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial Arabidopsis thaliana
P21913 2.39e-87 263 56 5 232 2 Sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Rattus norvegicus
Q9CQA3 4.92e-87 262 55 5 233 1 Sdhb Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Mus musculus
Q70KF8 1.45e-86 261 55 6 230 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Uromyces fabae
Q59662 4.94e-86 259 54 5 233 3 sdhB Succinate dehydrogenase iron-sulfur subunit Paracoccus denitrificans
Q9YHT2 8.72e-86 259 55 5 233 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Gallus gallus
O42772 2.75e-85 258 54 4 231 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Zymoseptoria tritici
P80480 3.26e-85 256 53 4 227 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Reclinomonas americana
P21801 1.04e-84 256 54 4 231 1 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P21911 3.78e-84 254 54 5 231 3 sdh2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O44074 9.11e-84 254 53 5 234 1 SDHB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Ascaris suum
A8WPF0 1.5e-83 253 53 6 234 3 sdhb-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Caenorhabditis briggsae
Q09545 3.75e-83 253 53 6 234 2 sdhb-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Caenorhabditis elegans
P32420 5.15e-83 252 53 5 229 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Ustilago maydis (strain 521 / FGSC 9021)
Q6FWS8 3.33e-82 249 52 4 231 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q9S827 7.06e-82 249 52 5 234 1 SDH2-1 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial Oryza sativa subsp. japonica
Q9FJP9 1.14e-79 244 51 7 236 1 SDH2-3 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial Arabidopsis thaliana
P48932 3.48e-79 241 50 4 229 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Chondrus crispus
Q55CC2 2.87e-77 237 50 6 238 3 sdhB Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial Dictyostelium discoideum
P48933 4.35e-76 233 49 3 229 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Cyanidium caldarium
P80477 1.96e-74 228 47 5 232 3 SDH2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit Porphyra purpurea
Q6H4G3 1.28e-69 219 46 6 233 1 SDH2-2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial Oryza sativa subsp. japonica
P9WN89 6.72e-46 156 36 6 232 1 frdB Fumarate reductase iron-sulfur subunit Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN88 6.72e-46 156 36 6 232 3 frdB Fumarate reductase iron-sulfur subunit Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0AC50 2.86e-45 154 37 4 230 3 frdB Fumarate reductase iron-sulfur subunit Shigella flexneri
P0AC47 2.86e-45 154 37 4 230 1 frdB Fumarate reductase iron-sulfur subunit Escherichia coli (strain K12)
P0AC48 2.86e-45 154 37 4 230 3 frdB Fumarate reductase iron-sulfur subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AC49 2.86e-45 154 37 4 230 3 frdB Fumarate reductase iron-sulfur subunit Escherichia coli O157:H7
P44893 4.43e-45 154 38 7 242 3 frdB Fumarate reductase iron-sulfur subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P20921 5.11e-44 151 38 4 231 3 frdB Fumarate reductase iron-sulfur subunit Proteus vulgaris
Q9ZMP1 4.34e-29 112 31 8 234 3 frdB Fumarate reductase iron-sulfur subunit Helicobacter pylori (strain J99 / ATCC 700824)
P17596 5.71e-29 112 31 9 234 1 frdB Fumarate reductase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
O06914 3.45e-28 110 31 8 234 3 frdB Fumarate reductase iron-sulfur subunit Helicobacter pylori (strain ATCC 700392 / 26695)
D9PUX5 8.49e-23 99 31 9 238 1 tfrB Fumarate reductase (CoM/CoB) subunit B Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q57557 3.8e-21 94 29 9 237 3 MJ0092 Uncharacterized iron-sulfur protein MJ0092 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q7M826 5.11e-21 92 28 3 220 1 sdhB 8-methylmenaquinol:fumarate reductase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q6LYC4 9.47e-16 79 29 6 195 3 MMP1067 Uncharacterized iron-sulfur protein MMP1067 Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
P08066 1.46e-14 73 23 6 236 3 sdhB Succinate dehydrogenase iron-sulfur subunit Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS00520
Feature type CDS
Gene -
Product succinate dehydrogenase iron-sulfur subunit
Location 109761 - 110477 (strand: 1)
Length 717 (nucleotides) / 238 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1569
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13085 2Fe-2S iron-sulfur cluster binding domain
PF13534 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0479 Energy production and conversion (C) C Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit

Kegg Ortholog Annotation(s)

Protein Sequence

MNVEFSVYRYNPDVDNAPHMQSYQLDVEEGRDMMVLDALIQLKEQDPTLSFRRSCREGVCGSDGINMNGKNGLACITPLSVLMKGGKKVVIRPLPGLPVVRDLVVDMGQFYAQYEKIRPYLINDSKNPPAREHLQSPVQREKLDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLAAYRFLIDSRDTETESRLDDISDAFSVFRCHGIMNCVSVCPKGLNPTKAIGHIKSMLLKRSA

Flanking regions ( +/- flanking 50bp)

AATTCGGACCTACTGATGTGTGGTGATAAGGCAATTGCGGAGAGAATACTATGAATGTTGAATTTTCAGTTTATCGCTATAACCCGGATGTTGATAACGCACCTCACATGCAGAGTTATCAGTTGGATGTGGAAGAAGGTCGCGACATGATGGTGCTGGATGCGTTAATCCAGCTGAAAGAACAGGATCCGACTTTGTCATTCCGCCGTTCCTGCCGTGAAGGTGTGTGTGGTTCTGACGGGATCAACATGAACGGCAAAAACGGTCTGGCCTGTATCACGCCGCTGTCGGTACTGATGAAAGGCGGTAAAAAGGTGGTGATCCGCCCGCTGCCGGGTCTGCCGGTTGTGCGTGACCTTGTGGTGGATATGGGGCAGTTTTATGCACAATATGAAAAAATTCGCCCGTATCTGATTAATGACAGCAAAAATCCGCCTGCGCGTGAGCACTTACAGTCACCGGTGCAGCGTGAAAAGCTGGATGGTCTGTATGAATGCATTCTGTGTGCCTGCTGCTCAACATCCTGCCCGTCGTTCTGGTGGAATCCGGATAAATTTGTCGGTCCTGCCGGTTTATTAGCCGCGTACCGTTTTCTGATCGACAGCCGTGATACTGAGACAGAATCACGTCTCGATGATATCAGTGATGCTTTCAGTGTTTTCCGCTGTCACGGCATCATGAACTGCGTCAGTGTTTGTCCGAAAGGGCTGAATCCGACAAAAGCAATCGGGCATATTAAATCAATGTTACTTAAACGCAGTGCATAATTTTGTTTTGTCTATATCCAACGTCATTCAGGATGCAGGCTGGCTGAATG