Homologs in group_198

Help

8 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11815 FBDBKF_11815 27.4 Morganella morganii S1 murP PTS N-acetylmuramic acid transporter subunit IIBC
EHELCC_14490 EHELCC_14490 27.4 Morganella morganii S2 murP PTS N-acetylmuramic acid transporter subunit IIBC
NLDBIP_15585 NLDBIP_15585 27.4 Morganella morganii S4 murP PTS N-acetylmuramic acid transporter subunit IIBC
LHKJJB_15025 LHKJJB_15025 27.4 Morganella morganii S3 murP PTS N-acetylmuramic acid transporter subunit IIBC
HKOGLL_14145 HKOGLL_14145 27.4 Morganella morganii S5 murP PTS N-acetylmuramic acid transporter subunit IIBC
F4V73_RS14840 F4V73_RS14840 28.3 Morganella psychrotolerans murP PTS N-acetylmuramic acid transporter subunit IIBC
PMI_RS10970 PMI_RS10970 27.1 Proteus mirabilis HI4320 - beta-glucoside-specific PTS transporter subunit IIABC
PMI_RS17475 PMI_RS17475 27.8 Proteus mirabilis HI4320 - PTS transporter subunit EIIC

Distribution of the homologs in the orthogroup group_198

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_198

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P36672 0.0 603 64 0 467 1 treB PTS system trehalose-specific EIIBC component Escherichia coli (strain K12)
P39794 3.61e-119 360 39 7 469 2 treP PTS system trehalose-specific EIIBC component Bacillus subtilis (strain 168)
Q9CJZ2 4.16e-96 301 36 7 469 3 scrA PTS system sucrose-specific EIIBC component Pasteurella multocida (strain Pm70)
P51184 5.59e-89 282 35 10 479 3 scrA PTS system sucrose-specific EIIBC component Staphylococcus xylosus
P22825 1.62e-88 281 34 7 464 3 scrA PTS system sucrose-specific EIIBC component Vibrio alginolyticus
P27219 6.62e-80 258 34 7 467 3 scrA PTS system sucrose-specific EIIBC component Klebsiella pneumoniae
P05306 2.85e-79 257 32 6 453 1 sacP PTS system sucrose-specific EIIBC component Bacillus subtilis (strain 168)
P08470 6.71e-79 256 35 7 462 3 scrA PTS system sucrose-specific EIIBC component Salmonella typhimurium
P43470 1.08e-71 242 33 7 458 3 scrA PTS system sucrose-specific EIIBCA component Pediococcus pentosaceus
P12655 8.72e-66 226 32 9 473 1 scrA PTS system sucrose-specific EIIBCA component Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P15400 3.63e-54 191 29 9 471 1 sacX Probable PTS system sucrose-specific EIIBC component Bacillus subtilis (strain 168)
Q9KF90 2.44e-52 189 30 6 421 3 bglP PTS system beta-glucoside-specific EIIBCA component Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q797S1 1.02e-48 176 27 9 468 3 ybbF Putative PTS system EIIBC component YbbF Bacillus subtilis (strain 168)
P40739 3.58e-41 158 29 9 434 3 bglP PTS system beta-glucoside-specific EIIBCA component Bacillus subtilis (strain 168)
P08722 7.08e-40 155 26 7 432 1 bglF PTS system beta-glucoside-specific EIIBCA component Escherichia coli (strain K12)
Q5E5T6 2.99e-38 148 27 7 412 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q9CKN5 2.67e-37 145 27 9 424 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Pasteurella multocida (strain Pm70)
P26207 4.67e-37 147 27 8 427 3 arbF PTS system beta-glucoside-specific EIIBCA component Dickeya chrysanthemi
Q87FD5 5.1e-37 145 27 10 417 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KVD9 2.45e-35 140 27 10 411 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7MBS2 2.55e-35 140 26 12 416 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Vibrio vulnificus (strain YJ016)
Q8D4Z3 4.39e-35 139 26 12 416 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Vibrio vulnificus (strain CMCP6)
Q46072 6.41e-34 138 26 14 480 4 ptsM PTS system mannose-specific EIIBCA component Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q4L8H5 1.14e-33 135 26 9 417 3 SH0741 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus haemolyticus (strain JCSC1435)
Q45298 9.18e-33 135 25 13 480 3 ptsG PTS system glucose-specific EIIBCA component Corynebacterium glutamicum
Q7A1Y1 5.99e-32 130 24 10 429 3 MW0166 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain MW2)
Q6GCT4 5.99e-32 130 24 10 429 3 SAS0167 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain MSSA476)
Q7A804 5.99e-32 130 24 10 429 1 SA0186 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain N315)
Q99X29 5.99e-32 130 24 10 429 3 SAV0192 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJI0 5.99e-32 130 24 10 429 3 SACOL0178 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain COL)
Q2G1G5 5.99e-32 130 24 10 429 3 SAOUHSC_00158 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK70 5.99e-32 130 24 10 429 1 murP PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain USA300)
Q8CNB2 8.57e-32 130 25 10 424 3 SE_1890 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLT2 8.57e-32 130 25 10 424 3 SERP1900 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q7N9D9 1.45e-31 130 26 13 444 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q49ZN7 1.47e-31 129 27 11 418 3 SSP0594 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q6GKB4 2.26e-31 129 24 10 429 3 SAR0193 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain MRSA252)
Q2YV12 2.77e-31 129 24 10 429 3 SAB0132 PTS system MurNAc-GlcNAc-specific EIIBC component Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8FFA9 4.59e-31 128 25 8 427 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8XBJ1 4.73e-31 128 26 9 422 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Escherichia coli O157:H7
Q1R8U3 5.21e-31 128 25 8 422 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Escherichia coli (strain UTI89 / UPEC)
Q32DC5 2.2e-30 126 26 9 422 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Shigella dysenteriae serotype 1 (strain Sd197)
P77272 3.65e-30 125 26 9 422 1 murP PTS system N-acetylmuramic acid-specific EIIBC component Escherichia coli (strain K12)
Q83QN3 4.83e-30 125 26 9 422 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Shigella flexneri
Q31Y50 9.61e-30 124 26 9 422 3 murP PTS system N-acetylmuramic acid-specific EIIBC component Shigella boydii serotype 4 (strain Sb227)
P24241 1.13e-26 115 25 9 424 3 ascF PTS system arbutin-, cellobiose-, and salicin-specific EIIBC component Escherichia coli (strain K12)
P54715 0.000239 47 35 0 59 1 malP PTS system maltose-specific EIICB component Bacillus subtilis (strain 168)
Q9S2H6 0.000609 42 33 1 63 1 nagF PTS system N-acetylglucosamine-specific EIIB component Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
O34521 0.000794 45 39 3 69 1 nagP PTS system N-acetylglucosamine-specific EIICB component Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01405
Feature type CDS
Gene treB
Product PTS trehalose transporter subunit IIBC
Location 347959 - 349380 (strand: -1)
Length 1422 (nucleotides) / 473 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_198
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF00367 phosphotransferase system, EIIB
PF02378 Phosphotransferase system, EIIC

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1263 Carbohydrate transport and metabolism (G) G Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02819 trehalose PTS system EIIBC or EIIBCA component [EC:2.7.1.201] Starch and sucrose metabolism
Phosphotransferase system (PTS)		 -

Protein Sequence

MSIPQDNQAIEELITLVGGSDNVISVSHCLTRLRFVLNDPNLADIDKIKKISFVKGCFNNAGQFQVIVGMDVDIYYKLLIDKLSLKAKSKDDIKSDAKKNMGSWQKLIANLAEIFVPLLPILICGGLLLGLRNVIGEMPISDNKPLTYFYPWLTPIYDFLWLPCEAIFHFLPVSICWSSVKKMGGTPALGIVLGITLVSPQLMNAYNLGSQLPEVWNFGLFTIEKVGYQAQVIPSILAGLFLGWFETKLRRFIPDYLKLVIVPIVTLIVAVFVAHVILGPIGRSIGDGLAQLIKFLMLGDFAPIGSTIFAFFYSPMVITGLHHTTLAIDLQMTQSYGGTPIWPIIALSNIAQASAVVGIIIVSRKLNEQEITIPAAISAYLGVTEPAMYGVNLKYGFPMLCAMIGAALAGLICGLNNVLSNGIGVGGLPGILSIQPTYWLVYLLAMIVAIVVPIGLTILVYRYKEKAGTLQVD

Flanking regions ( +/- flanking 50bp)

GAAAGATCTCGATATATTAAAAATAACCCTACTATTATGAGAATATTAATATGTCGATACCTCAAGACAACCAAGCCATTGAAGAGTTAATTACTCTTGTTGGAGGTTCAGATAATGTTATTAGCGTTTCACACTGTCTAACCAGATTACGTTTTGTTCTGAATGATCCCAATCTTGCTGATATAGATAAAATTAAAAAAATATCTTTTGTTAAAGGCTGTTTTAATAATGCGGGTCAATTTCAAGTTATTGTTGGTATGGATGTTGATATCTACTATAAATTATTAATTGATAAGCTTTCATTAAAAGCTAAATCTAAAGATGATATAAAATCTGATGCGAAAAAGAATATGGGATCCTGGCAAAAGCTGATTGCCAATTTAGCCGAAATTTTTGTTCCATTATTACCTATCTTAATTTGCGGCGGTTTATTGTTAGGATTAAGAAATGTTATTGGCGAAATGCCTATATCAGATAATAAACCCCTCACTTATTTTTATCCTTGGTTAACACCAATATATGATTTTCTCTGGTTACCTTGTGAAGCCATCTTCCATTTTCTACCTGTGAGTATTTGCTGGTCAAGTGTAAAAAAGATGGGTGGTACACCTGCACTAGGTATCGTACTAGGTATAACCTTAGTTTCTCCACAGCTAATGAATGCTTACAATTTAGGTTCACAACTTCCTGAGGTTTGGAATTTTGGTTTATTTACTATTGAGAAAGTAGGTTATCAAGCCCAAGTGATCCCTTCGATTTTAGCGGGACTATTTCTGGGATGGTTTGAGACTAAATTACGTCGTTTTATCCCTGATTACCTAAAATTAGTTATTGTGCCGATTGTAACTCTTATTGTCGCCGTTTTTGTTGCCCATGTTATTTTAGGCCCTATCGGTAGAAGCATAGGTGATGGTCTCGCCCAACTGATCAAGTTTTTAATGTTAGGTGATTTTGCCCCTATTGGTTCAACTATTTTTGCCTTTTTCTATTCCCCCATGGTGATCACCGGCTTACATCACACAACGTTAGCGATAGATTTACAAATGACTCAAAGTTATGGCGGTACACCTATTTGGCCGATTATCGCTCTGTCTAATATTGCTCAAGCATCTGCCGTTGTAGGCATTATTATCGTTAGTCGCAAATTAAATGAACAAGAAATTACTATTCCGGCAGCTATCTCTGCTTATTTAGGTGTGACAGAGCCAGCCATGTATGGCGTCAACTTAAAATATGGCTTTCCTATGCTGTGCGCCATGATTGGCGCTGCGCTAGCGGGTTTGATTTGTGGATTAAATAATGTGCTATCTAATGGTATTGGTGTCGGCGGATTACCCGGTATTTTATCTATCCAACCTACTTATTGGTTAGTTTATTTATTAGCAATGATTGTGGCTATTGTCGTCCCTATTGGATTAACCATTCTGGTCTATCGCTATAAAGAAAAAGCAGGCACCTTGCAAGTCGATTAATTTAATCTCAAACTAAAGGTTAAACATGAATTATATCTCTATTATTCTTT