Homologs in group_281

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09040 FBDBKF_09040 50.8 Morganella morganii S1 fimA Pilin (type 1 fimbrial protein)
EHELCC_10370 EHELCC_10370 50.8 Morganella morganii S2 fimA Pilin (type 1 fimbrial protein)
NLDBIP_10715 NLDBIP_10715 50.8 Morganella morganii S4 fimA Pilin (type 1 fimbrial protein)
LHKJJB_10640 LHKJJB_10640 50.8 Morganella morganii S3 fimA Pilin (type 1 fimbrial protein)
HKOGLL_13700 HKOGLL_13700 50.8 Morganella morganii S5 fimA Pilin (type 1 fimbrial protein)
F4V73_RS10930 F4V73_RS10930 47.0 Morganella psychrotolerans - type 1 fimbrial protein
PMI_RS10950 PMI_RS10950 25.3 Proteus mirabilis HI4320 - fimbrial protein

Distribution of the homologs in the orthogroup group_281

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_281

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P42185 1.06e-20 87 34 1 146 3 prsH PRS fimbrial minor pilin protein Escherichia coli
P07111 1.49e-20 87 34 1 146 1 papH PAP fimbrial minor pilin protein Escherichia coli
Q03011 1.88e-05 46 27 3 140 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
P37909 0.000716 42 23 4 183 1 ybgD Uncharacterized fimbrial-like protein YbgD Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01280
Feature type CDS
Gene mrpB
Product MR/P fimbria assembly terminator MrpB
Location 311971 - 312519 (strand: 1)
Length 549 (nucleotides) / 182 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_281
Orthogroup size 8
N. genomes 7

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG042622 MR/P fimbria assembly terminator MrpB VF1233 Adherence

Protein Sequence

MAPLLLCLVASLVTAPTIASDVKQDKNMHQRFGWLNLQGTILEPSCAISAGSSDQVIPLTTVSIPTLVTEGQGPIEYFSIRLTDCTLISQKGQEADNPRFIATFDGPSNGNGNFELSGEAKGASLAIADRYGRQAIPGQPLPPVGIDSQSMALLYQARIVKNNDTPKAGNYRTTLRFKLEYY

Flanking regions ( +/- flanking 50bp)

TTTACTTTTAATGATTTTTCTTACTAACGGAGAAAAATATGAATCGCAAGATGGCACCACTATTGCTATGCCTTGTTGCCAGTTTAGTGACTGCGCCAACGATAGCCAGTGATGTAAAACAAGATAAAAACATGCATCAGCGATTTGGGTGGCTCAATCTACAAGGAACCATATTAGAGCCGTCATGTGCAATATCAGCGGGAAGTAGTGATCAAGTGATCCCGCTAACGACGGTATCTATCCCAACGTTAGTCACTGAAGGTCAAGGACCGATTGAATATTTTTCTATCAGATTAACGGACTGTACGCTAATTAGCCAGAAAGGGCAAGAAGCGGATAATCCACGTTTTATCGCAACGTTCGATGGTCCTTCTAATGGAAATGGCAACTTTGAGTTATCCGGTGAGGCCAAAGGTGCTTCATTAGCGATAGCGGATCGTTATGGTCGACAAGCTATTCCAGGACAACCCCTACCGCCCGTTGGCATTGATTCGCAGTCAATGGCATTGCTGTACCAAGCTCGAATAGTCAAAAATAACGATACGCCAAAAGCGGGGAATTACCGTACGACGCTGCGCTTTAAGCTGGAATACTATTAAATGGATCAGGGTTGGATAATTTATGGTTAGATCATTCAAAACCGTTTGTT