Homologs in group_11

Help

18 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04505 FBDBKF_04505 42.3 Morganella morganii S1 mglA galactose/methyl galactoside ABC transporter ATP-binding protein MglA
FBDBKF_04700 FBDBKF_04700 44.5 Morganella morganii S1 xylG ABC-type sugar transport system, ATPase component
FBDBKF_15410 FBDBKF_15410 84.4 Morganella morganii S1 rbsA ribose ABC transporter ATP-binding protein RbsA
EHELCC_05795 EHELCC_05795 42.3 Morganella morganii S2 mglA galactose/methyl galactoside ABC transporter ATP-binding protein MglA
EHELCC_05990 EHELCC_05990 44.5 Morganella morganii S2 xylG ABC-type sugar transport system, ATPase component
EHELCC_15770 EHELCC_15770 84.4 Morganella morganii S2 rbsA ribose ABC transporter ATP-binding protein RbsA
NLDBIP_06115 NLDBIP_06115 42.3 Morganella morganii S4 mglA galactose/methyl galactoside ABC transporter ATP-binding protein MglA
NLDBIP_06310 NLDBIP_06310 44.5 Morganella morganii S4 xylG ABC-type sugar transport system, ATPase component
NLDBIP_16600 NLDBIP_16600 84.4 Morganella morganii S4 rbsA ribose ABC transporter ATP-binding protein RbsA
LHKJJB_02995 LHKJJB_02995 42.3 Morganella morganii S3 mglA galactose/methyl galactoside ABC transporter ATP-binding protein MglA
LHKJJB_03190 LHKJJB_03190 44.5 Morganella morganii S3 xylG ABC-type sugar transport system, ATPase component
LHKJJB_16205 LHKJJB_16205 84.4 Morganella morganii S3 rbsA ribose ABC transporter ATP-binding protein RbsA
HKOGLL_06470 HKOGLL_06470 42.3 Morganella morganii S5 mglA galactose/methyl galactoside ABC transporter ATP-binding protein MglA
HKOGLL_06665 HKOGLL_06665 44.5 Morganella morganii S5 xylG ABC-type sugar transport system, ATPase component
HKOGLL_15975 HKOGLL_15975 84.4 Morganella morganii S5 rbsA ribose ABC transporter ATP-binding protein RbsA
F4V73_RS09120 F4V73_RS09120 41.4 Morganella psychrotolerans - sugar ABC transporter ATP-binding protein
F4V73_RS09175 F4V73_RS09175 46.1 Morganella psychrotolerans - sugar ABC transporter ATP-binding protein
F4V73_RS17735 F4V73_RS17735 84.6 Morganella psychrotolerans rbsA ribose ABC transporter ATP-binding protein RbsA

Distribution of the homologs in the orthogroup group_11

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_11

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7NA79 0.0 801 78 0 498 3 rbsA Ribose import ATP-binding protein RbsA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6DB87 0.0 792 77 0 498 3 rbsA Ribose import ATP-binding protein RbsA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q57HW1 0.0 769 75 0 494 3 rbsA Ribose import ATP-binding protein RbsA Salmonella choleraesuis (strain SC-B67)
Q57HW1 3.09e-17 87 26 4 236 3 rbsA Ribose import ATP-binding protein RbsA Salmonella choleraesuis (strain SC-B67)
Q1R4I3 0.0 769 75 0 494 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli (strain UTI89 / UPEC)
Q1R4I3 9.05e-17 86 26 4 236 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli (strain UTI89 / UPEC)
Q8ZKV9 0.0 769 75 0 494 3 rbsA Ribose import ATP-binding protein RbsA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZKV9 3.26e-17 87 26 4 236 3 rbsA Ribose import ATP-binding protein RbsA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P04983 0.0 769 75 0 494 1 rbsA Ribose import ATP-binding protein RbsA Escherichia coli (strain K12)
P04983 8.43e-17 86 26 4 236 1 rbsA Ribose import ATP-binding protein RbsA Escherichia coli (strain K12)
Q0TAW0 0.0 769 75 0 494 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TAW0 8.43e-17 86 26 4 236 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8Z2R4 0.0 768 75 0 494 3 rbsA Ribose import ATP-binding protein RbsA Salmonella typhi
Q8Z2R4 3.47e-17 87 26 4 236 3 rbsA Ribose import ATP-binding protein RbsA Salmonella typhi
Q8FBS3 0.0 767 75 0 494 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FBS3 1.42e-16 85 26 4 236 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8XAW7 0.0 766 75 0 494 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Escherichia coli O157:H7
Q8XAW7 1.85e-16 85 26 4 236 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Escherichia coli O157:H7
Q5PJX5 0.0 766 75 0 494 3 rbsA Ribose import ATP-binding protein RbsA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PJX5 2.34e-16 85 26 4 236 3 rbsA Ribose import ATP-binding protein RbsA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q3YVK8 0.0 764 75 0 494 3 rbsA Ribose import ATP-binding protein RbsA Shigella sonnei (strain Ss046)
Q3YVK8 3.25e-16 84 26 4 236 3 rbsA Ribose import ATP-binding protein RbsA Shigella sonnei (strain Ss046)
Q8D7T7 0.0 720 72 1 494 3 rbsA Ribose import ATP-binding protein RbsA Vibrio vulnificus (strain CMCP6)
Q8D7T7 4.37e-14 78 26 3 221 3 rbsA Ribose import ATP-binding protein RbsA Vibrio vulnificus (strain CMCP6)
Q7MEV1 0.0 719 72 1 494 3 rbsA Ribose import ATP-binding protein RbsA Vibrio vulnificus (strain YJ016)
Q7MEV1 3.53e-14 78 26 3 221 3 rbsA Ribose import ATP-binding protein RbsA Vibrio vulnificus (strain YJ016)
Q87H79 0.0 717 72 1 494 3 rbsA Ribose import ATP-binding protein RbsA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87H79 2.8e-14 78 26 4 222 3 rbsA Ribose import ATP-binding protein RbsA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9CP98 0.0 715 72 1 493 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Pasteurella multocida (strain Pm70)
Q9CP98 1.44e-17 89 26 4 242 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Pasteurella multocida (strain Pm70)
Q5E4V6 0.0 712 70 1 501 3 rbsA Ribose import ATP-binding protein RbsA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q6LH11 0.0 704 70 1 493 3 rbsA Ribose import ATP-binding protein RbsA Photobacterium profundum (strain SS9)
Q6LH11 2.64e-19 94 26 3 228 3 rbsA Ribose import ATP-binding protein RbsA Photobacterium profundum (strain SS9)
Q6LH11 2.24e-17 88 27 6 248 3 rbsA Ribose import ATP-binding protein RbsA Photobacterium profundum (strain SS9)
Q9KN37 0.0 703 71 1 493 3 rbsA Ribose import ATP-binding protein RbsA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9KN37 3.59e-20 97 28 4 227 3 rbsA Ribose import ATP-binding protein RbsA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P44735 0.0 696 69 1 494 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44735 7.61e-17 86 25 3 228 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QN44 0.0 694 69 1 494 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain 86-028NP)
Q4QN44 7.02e-17 86 25 3 228 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain 86-028NP)
Q8RD43 1.36e-177 511 51 1 494 3 rbsA Ribose import ATP-binding protein RbsA Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8RD43 4.17e-24 108 29 3 228 3 rbsA Ribose import ATP-binding protein RbsA Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q0SSJ0 1.23e-171 496 51 2 492 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain SM101 / Type A)
Q0SSJ0 1e-17 89 25 3 227 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain SM101 / Type A)
Q0TPX5 8.37e-171 494 51 2 492 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0TPX5 1.12e-17 89 25 3 227 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8XJX3 1.94e-170 493 51 2 492 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain 13 / Type A)
Q8XJX3 1.71e-17 88 25 3 227 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain 13 / Type A)
Q891M1 1.72e-167 485 49 2 492 3 rbsA Ribose import ATP-binding protein RbsA Clostridium tetani (strain Massachusetts / E88)
Q891M1 7.96e-20 95 27 3 230 3 rbsA Ribose import ATP-binding protein RbsA Clostridium tetani (strain Massachusetts / E88)
Q8RBQ1 8.12e-165 478 50 2 491 3 TTE0763 Putative ribose/galactose/methyl galactoside import ATP-binding protein Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q5KYS1 1.57e-163 475 49 5 500 3 xylG Xylose import ATP-binding protein XylG Geobacillus kaustophilus (strain HTA426)
Q5KYS1 3.17e-15 81 25 4 232 3 xylG Xylose import ATP-binding protein XylG Geobacillus kaustophilus (strain HTA426)
Q5KYS1 2.45e-14 79 25 4 239 3 xylG Xylose import ATP-binding protein XylG Geobacillus kaustophilus (strain HTA426)
Q4ZRC6 2.88e-163 475 49 2 493 3 Psyr_3264 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas syringae pv. syringae (strain B728a)
Q4ZRC6 2.31e-16 85 25 3 219 3 Psyr_3264 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas syringae pv. syringae (strain B728a)
Q4KDI2 5.92e-163 474 48 2 491 3 PFL_2594 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4KDI2 8.38e-16 83 26 4 232 3 PFL_2594 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q87ZE0 4.82e-162 472 49 2 493 3 PSPTO_3489 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q87ZE0 8.7e-16 83 25 3 219 3 PSPTO_3489 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q5KUX3 5.68e-161 468 47 4 493 3 rbsA Ribose import ATP-binding protein RbsA Geobacillus kaustophilus (strain HTA426)
Q5KUX3 1.04e-22 104 28 4 235 3 rbsA Ribose import ATP-binding protein RbsA Geobacillus kaustophilus (strain HTA426)
Q48GY7 1.77e-159 466 48 2 493 3 PSPPH_3184 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q48GY7 2.02e-14 79 23 3 219 3 PSPPH_3184 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q6HNE7 1.35e-158 462 47 3 491 3 rbsA Ribose import ATP-binding protein RbsA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HNE7 1.98e-18 91 26 3 230 3 rbsA Ribose import ATP-binding protein RbsA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81V36 1.35e-158 462 47 3 491 3 rbsA Ribose import ATP-binding protein RbsA Bacillus anthracis
Q81V36 1.98e-18 91 26 3 230 3 rbsA Ribose import ATP-binding protein RbsA Bacillus anthracis
Q8UBN2 1.64e-158 462 47 4 496 3 Atu2819 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q13FD9 4.05e-158 461 47 3 498 3 Bxeno_C1272 Putative ribose/galactose/methyl galactoside import ATP-binding protein Paraburkholderia xenovorans (strain LB400)
Q65E55 5.56e-158 461 48 2 490 3 rbsA Ribose import ATP-binding protein RbsA Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q81HW8 8.16e-158 461 47 3 491 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81HW8 4.96e-17 87 26 5 234 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q63FX9 1.18e-157 460 47 3 491 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ZK / E33L)
Q63FX9 1.75e-18 91 26 3 230 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ZK / E33L)
Q9X051 1.34e-157 461 48 5 504 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9X051 5.55e-17 87 26 4 229 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q6VMN4 3.61e-157 459 48 6 505 3 xylG Xylose import ATP-binding protein XylG Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q6VMN4 8.71e-20 95 27 5 249 3 xylG Xylose import ATP-binding protein XylG Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q6VMN4 2.42e-18 91 27 5 240 3 xylG Xylose import ATP-binding protein XylG Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q8ENB3 7.93e-157 458 47 2 488 3 rbsA Ribose import ATP-binding protein RbsA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q0BFU0 1.15e-156 458 46 6 502 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q0B775 2.51e-156 457 47 4 497 3 Bamb_4447 Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q73DH7 3.47e-156 456 47 3 491 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q73DH7 4.67e-19 93 26 3 230 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ATCC 10987 / NRS 248)
P36947 5.87e-155 453 46 2 490 3 rbsA Ribose import ATP-binding protein RbsA Bacillus subtilis (strain 168)
Q6LK34 9.4e-155 452 47 3 493 3 mglA1 Galactose/methyl galactoside import ATP-binding protein MglA 1 Photobacterium profundum (strain SS9)
Q6LK34 4.51e-15 81 24 4 234 3 mglA1 Galactose/methyl galactoside import ATP-binding protein MglA 1 Photobacterium profundum (strain SS9)
Q1BWN5 1.36e-154 453 45 6 502 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia orbicola (strain AU 1054)
A0K718 1.36e-154 453 45 6 502 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia cenocepacia (strain HI2424)
Q2T8T6 2.75e-154 452 45 6 502 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q8E7N9 3.49e-154 451 47 1 489 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype III (strain NEM316)
Q8E7N9 9.45e-19 92 27 4 225 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype III (strain NEM316)
Q8E7N9 1.29e-18 92 27 4 239 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype III (strain NEM316)
Q3K3R2 4.48e-154 451 47 1 489 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q3K3R2 9.2e-19 92 27 4 239 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q3K3R2 1.36e-18 92 27 4 225 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q3JHZ1 5.28e-154 451 45 6 506 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia pseudomallei (strain 1710b)
Q63P06 1.86e-153 450 45 6 506 3 rbsA Ribose import ATP-binding protein RbsA Burkholderia pseudomallei (strain K96243)
Q8E281 3.11e-153 449 47 1 489 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E281 2.31e-18 91 27 4 225 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E281 3.35e-18 90 26 4 239 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q2SMT0 4.55e-152 446 45 1 475 3 HCH_01167 Putative ribose/galactose/methyl galactoside import ATP-binding protein Hahella chejuensis (strain KCTC 2396)
Q2SMT0 1.23e-17 89 27 3 228 3 HCH_01167 Putative ribose/galactose/methyl galactoside import ATP-binding protein Hahella chejuensis (strain KCTC 2396)
Q39GY8 5.02e-152 446 45 6 502 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q825P1 1.05e-151 445 44 2 486 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q399X3 1.64e-151 445 46 4 498 3 Bcep18194_B0624 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q7UU57 1.99e-151 445 45 5 502 3 rbsA Ribose import ATP-binding protein RbsA Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q5KYQ7 7.32e-151 443 45 3 493 3 GK1894 Putative ribose/galactose/methyl galactoside import ATP-binding protein Geobacillus kaustophilus (strain HTA426)
Q5KYQ7 1.6e-15 82 26 3 225 3 GK1894 Putative ribose/galactose/methyl galactoside import ATP-binding protein Geobacillus kaustophilus (strain HTA426)
Q5KYQ7 1.36e-14 79 22 5 227 3 GK1894 Putative ribose/galactose/methyl galactoside import ATP-binding protein Geobacillus kaustophilus (strain HTA426)
Q9CF44 9.15e-151 442 47 1 491 3 rbsA Ribose import ATP-binding protein RbsA Lactococcus lactis subsp. lactis (strain IL1403)
Q8CK44 1.04e-150 442 44 2 486 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q2KAW9 1.61e-150 443 46 3 496 3 RHE_CH01212 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2KAW9 3.7e-11 68 26 5 217 3 RHE_CH01212 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8FCE2 2.2e-150 442 45 4 507 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FCE2 2.36e-14 79 27 4 233 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBN5 2.2e-150 442 45 4 507 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TBN5 2.36e-14 79 27 4 233 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1BX03 4.41e-150 442 43 1 491 3 Bcen_0943 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia orbicola (strain AU 1054)
Q1BX03 3.62e-17 87 26 5 243 3 Bcen_0943 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia orbicola (strain AU 1054)
A0K6Q0 4.41e-150 442 43 1 491 3 Bcen2424_1425 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia cenocepacia (strain HI2424)
A0K6Q0 3.62e-17 87 26 5 243 3 Bcen2424_1425 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia cenocepacia (strain HI2424)
Q1BQ82 4.7e-150 441 45 3 497 3 Bcen_3328 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia orbicola (strain AU 1054)
A0B297 4.7e-150 441 45 3 497 3 Bcen2424_5039 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia cenocepacia (strain HI2424)
Q39HA1 4.76e-150 442 43 2 492 3 Bcep18194_A4569 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q39HA1 1.08e-16 86 25 5 243 3 Bcep18194_A4569 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q7NTN6 5.77e-150 441 46 4 489 3 rbsA Ribose import ATP-binding protein RbsA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7NTN6 4.26e-14 78 28 3 230 3 rbsA Ribose import ATP-binding protein RbsA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9K6J9 8.52e-150 440 45 4 494 3 rbsA Ribose import ATP-binding protein RbsA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9K6J9 3.58e-19 94 26 5 234 3 rbsA Ribose import ATP-binding protein RbsA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q1R528 9.43e-150 441 45 4 507 3 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain UTI89 / UPEC)
Q1R528 2.45e-14 79 27 4 233 3 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain UTI89 / UPEC)
Q664G2 1.29e-149 440 45 4 492 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q664G2 2.14e-24 109 31 4 224 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q31V51 1.31e-149 440 45 4 507 3 xylG Xylose import ATP-binding protein XylG Shigella boydii serotype 4 (strain Sb227)
Q31V51 2.47e-14 79 27 4 233 3 xylG Xylose import ATP-binding protein XylG Shigella boydii serotype 4 (strain Sb227)
Q8XDM1 1.31e-149 440 45 4 507 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O157:H7
Q8XDM1 2.47e-14 79 27 4 233 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O157:H7
Q2RGX2 2.53e-149 439 46 5 501 3 xylG Xylose import ATP-binding protein XylG Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q2RGX2 2.7e-15 82 26 4 227 3 xylG Xylose import ATP-binding protein XylG Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q2RGX2 9.44e-14 77 26 6 246 3 xylG Xylose import ATP-binding protein XylG Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
P37388 2.53e-149 439 45 4 507 1 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain K12)
P37388 9e-14 77 27 4 233 1 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain K12)
Q0BG60 4.51e-149 439 44 2 492 3 Bamb_1305 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q0BG60 4.65e-16 84 26 5 243 3 Bamb_1305 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q8X5Q4 4.6e-149 439 45 4 492 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Escherichia coli O157:H7
Q8X5Q4 2.21e-24 109 30 3 224 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Escherichia coli O157:H7
Q0SY86 6.04e-149 439 45 4 507 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri serotype 5b (strain 8401)
Q0SY86 4.28e-14 78 27 4 233 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri serotype 5b (strain 8401)
Q82CM5 6.52e-149 439 46 5 497 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q21TR5 6.95e-149 438 47 5 504 3 Rfer_3129 Putative ribose/galactose/methyl galactoside import ATP-binding protein Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q92S10 9.62e-149 437 43 2 494 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rhizobium meliloti (strain 1021)
Q92S10 1.4e-14 79 28 5 233 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rhizobium meliloti (strain 1021)
Q9KAG5 9.74e-149 438 46 3 493 3 BH2322 Putative ribose/galactose/methyl galactoside import ATP-binding protein Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KAG5 1.04e-16 86 26 3 225 3 BH2322 Putative ribose/galactose/methyl galactoside import ATP-binding protein Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q02XM9 1.06e-148 437 46 1 489 3 rbsA Ribose import ATP-binding protein RbsA Lactococcus lactis subsp. cremoris (strain SK11)
Q02XM9 4.84e-19 93 28 4 225 3 rbsA Ribose import ATP-binding protein RbsA Lactococcus lactis subsp. cremoris (strain SK11)
Q6DB03 1.16e-148 438 44 4 509 3 xylG Xylose import ATP-binding protein XylG Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q1CDJ0 1.18e-148 437 44 4 492 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CDJ0 2.04e-24 109 31 4 224 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CG00 1.18e-148 437 44 4 492 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis
Q7CG00 2.04e-24 109 31 4 224 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis
Q1C1B8 1.18e-148 437 44 4 492 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C1B8 2.04e-24 109 31 4 224 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Antiqua)
Q576H3 1.91e-148 437 47 6 505 3 xylG Xylose import ATP-binding protein XylG Brucella abortus biovar 1 (strain 9-941)
Q576H3 2.45e-17 88 28 3 219 3 xylG Xylose import ATP-binding protein XylG Brucella abortus biovar 1 (strain 9-941)
Q2YJE7 1.91e-148 437 47 6 505 3 xylG Xylose import ATP-binding protein XylG Brucella abortus (strain 2308)
Q2YJE7 2.45e-17 88 28 3 219 3 xylG Xylose import ATP-binding protein XylG Brucella abortus (strain 2308)
Q663Y5 2.02e-148 437 44 4 510 3 xylG Xylose import ATP-binding protein XylG Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CDC0 2.02e-148 437 44 4 510 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CFR2 2.02e-148 437 44 4 510 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis
Q1C0D5 2.02e-148 437 44 4 510 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Antiqua)
Q1AXG5 3.62e-148 436 45 3 492 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q2NUD6 9.02e-148 435 44 4 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Sodalis glossinidius (strain morsitans)
Q2NUD6 6.32e-15 80 24 3 227 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Sodalis glossinidius (strain morsitans)
Q8YDN0 1.42e-147 435 47 6 505 3 xylG Xylose import ATP-binding protein XylG Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8YDN0 5.1e-17 87 28 3 219 3 xylG Xylose import ATP-binding protein XylG Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q6LUY1 2.37e-147 434 44 6 509 3 xylG Xylose import ATP-binding protein XylG Photobacterium profundum (strain SS9)
Q8XKQ2 4.08e-147 434 44 5 502 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain 13 / Type A)
Q83J33 4.08e-147 434 45 4 507 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri
Q83J33 3.78e-13 75 27 4 233 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri
Q8Y003 5.47e-147 434 43 1 491 3 RSc1242 Putative ribose/galactose/methyl galactoside import ATP-binding protein Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8Y003 9.33e-17 86 26 4 229 3 RSc1242 Putative ribose/galactose/methyl galactoside import ATP-binding protein Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8UAK2 5.48e-147 434 43 1 491 3 Atu3371 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8UAK2 6.7e-19 93 26 3 228 3 Atu3371 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9RDI1 1.18e-146 433 46 4 497 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q66C83 1.99e-146 432 43 4 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q66C83 1.68e-14 79 25 4 227 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CGT1 1.99e-146 432 43 4 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CGT1 1.68e-14 79 25 4 227 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CHQ3 1.99e-146 432 43 4 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pestis
Q7CHQ3 1.68e-14 79 25 4 227 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pestis
Q1C9V1 1.99e-146 432 43 4 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C9V1 1.68e-14 79 25 4 227 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pestis bv. Antiqua (strain Antiqua)
Q8FUR8 2.32e-146 432 46 6 505 3 xylG Xylose import ATP-binding protein XylG Brucella suis biovar 1 (strain 1330)
Q8FUR8 6.99e-16 83 27 3 219 3 xylG Xylose import ATP-binding protein XylG Brucella suis biovar 1 (strain 1330)
Q0TQU8 2.4e-146 432 44 5 502 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q2K353 5.24e-146 431 44 1 491 3 RHE_CH03989 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2K353 1.16e-20 98 28 4 229 3 RHE_CH03989 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8U9B0 5.35e-146 431 44 3 492 3 Atu3818 Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q1BGC0 6.8e-146 431 45 3 498 3 Bcen_6474 Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 Burkholderia orbicola (strain AU 1054)
A0KE25 6.8e-146 431 45 3 498 3 Bcen2424_6709 Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 Burkholderia cenocepacia (strain HI2424)
Q5WC31 9.31e-146 430 43 4 494 3 rbsA Ribose import ATP-binding protein RbsA Shouchella clausii (strain KSM-K16)
P23924 9.84e-146 430 43 2 493 1 mglA Galactose/methyl galactoside import ATP-binding protein MglA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P23924 3.43e-16 84 26 3 227 1 mglA Galactose/methyl galactoside import ATP-binding protein MglA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q3Z057 1.5e-145 429 43 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella sonnei (strain Ss046)
Q3Z057 1.68e-15 82 26 3 227 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella sonnei (strain Ss046)
P0AAG9 1.5e-145 429 43 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella flexneri
P0AAG9 1.68e-15 82 26 3 227 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella flexneri
P0AAG8 1.5e-145 429 43 2 493 1 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli (strain K12)
P0AAG8 1.68e-15 82 26 3 227 1 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli (strain K12)
Q1R9S4 1.73e-145 429 43 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli (strain UTI89 / UPEC)
Q1R9S4 1.16e-15 83 26 4 230 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli (strain UTI89 / UPEC)
Q1ARR5 1.79e-145 429 44 4 500 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q1ARR5 5.51e-21 99 29 4 244 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q1ARR5 1.59e-15 82 23 3 230 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q0ST95 1.83e-145 430 44 5 502 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain SM101 / Type A)
Q8FFU7 1.87e-145 429 43 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FFU7 1.75e-15 82 26 3 227 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFU2 1.87e-145 429 43 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TFU2 1.75e-15 82 26 3 227 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0T2X5 2.82e-145 429 43 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella flexneri serotype 5b (strain 8401)
Q0T2X5 2.12e-15 82 26 3 227 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella flexneri serotype 5b (strain 8401)
Q8X5D9 6.58e-145 428 43 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O157:H7
Q8X5D9 1.4e-15 82 26 3 227 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O157:H7
Q3MB44 9e-145 428 46 6 496 3 rbsA Ribose import ATP-binding protein RbsA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q3MB44 4.66e-20 96 26 3 230 3 rbsA Ribose import ATP-binding protein RbsA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q13RB6 2.58e-144 427 44 5 503 3 xylG Xylose import ATP-binding protein XylG Paraburkholderia xenovorans (strain LB400)
Q13RB6 8.64e-15 80 27 5 246 3 xylG Xylose import ATP-binding protein XylG Paraburkholderia xenovorans (strain LB400)
Q1MAA2 3.73e-144 426 43 1 491 3 RL4654 Putative ribose/galactose/methyl galactoside import ATP-binding protein Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1MAA2 4.52e-22 102 29 4 229 3 RL4654 Putative ribose/galactose/methyl galactoside import ATP-binding protein Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q31YV7 4.4e-144 426 43 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella boydii serotype 4 (strain Sb227)
Q31YV7 1.23e-15 82 26 3 227 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella boydii serotype 4 (strain Sb227)
Q6LG59 4.4e-144 426 43 2 493 3 mglA2 Galactose/methyl galactoside import ATP-binding protein MglA 2 Photobacterium profundum (strain SS9)
Q6LG59 4.38e-12 72 23 3 225 3 mglA2 Galactose/methyl galactoside import ATP-binding protein MglA 2 Photobacterium profundum (strain SS9)
Q65UW1 1.11e-143 425 43 4 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q65UW1 2.32e-13 75 23 4 233 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8REE1 2.12e-143 424 43 2 491 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8REE1 1.53e-15 82 25 5 233 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8REE1 1.28e-11 70 21 5 242 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8XPK6 3.07e-143 424 44 5 501 3 xylG Xylose import ATP-binding protein XylG Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8XPK6 2.73e-13 75 27 5 242 3 xylG Xylose import ATP-binding protein XylG Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q65WJ1 3.46e-143 423 45 3 490 3 araG Arabinose import ATP-binding protein AraG Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q92TS8 6.7e-143 423 43 1 491 3 RB1420 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Rhizobium meliloti (strain 1021)
Q92TS8 1.39e-20 98 29 4 229 3 RB1420 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Rhizobium meliloti (strain 1021)
Q1AVD3 6.83e-143 423 44 3 492 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q1AVD3 3.37e-15 81 25 3 230 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q1BG93 1.7e-142 422 44 5 503 3 xylG Xylose import ATP-binding protein XylG Burkholderia orbicola (strain AU 1054)
Q1BG93 2.59e-16 85 26 4 230 3 xylG Xylose import ATP-binding protein XylG Burkholderia orbicola (strain AU 1054)
A0KE53 1.7e-142 422 44 5 503 3 xylG Xylose import ATP-binding protein XylG Burkholderia cenocepacia (strain HI2424)
A0KE53 2.59e-16 85 26 4 230 3 xylG Xylose import ATP-binding protein XylG Burkholderia cenocepacia (strain HI2424)
Q329G7 2.37e-142 421 44 4 492 3 rbsA Ribose import ATP-binding protein RbsA Shigella dysenteriae serotype 1 (strain Sd197)
Q329G7 2.77e-23 106 30 4 225 3 rbsA Ribose import ATP-binding protein RbsA Shigella dysenteriae serotype 1 (strain Sd197)
Q92W60 5.1e-142 421 42 3 495 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium meliloti (strain 1021)
Q92W60 6.7e-21 99 30 5 240 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium meliloti (strain 1021)
Q87FK7 3.23e-141 419 43 3 492 3 araG Arabinose import ATP-binding protein AraG Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q896Y2 5.44e-141 418 44 2 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium tetani (strain Massachusetts / E88)
Q896Y2 1.07e-19 95 27 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium tetani (strain Massachusetts / E88)
Q0BGD7 7.84e-141 418 44 5 498 3 Bamb_1228 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q2SJ99 2.23e-140 416 43 2 497 3 rbsA Ribose import ATP-binding protein RbsA Hahella chejuensis (strain KCTC 2396)
Q2SJ99 2.08e-16 85 25 3 228 3 rbsA Ribose import ATP-binding protein RbsA Hahella chejuensis (strain KCTC 2396)
Q9CL63 2.7e-140 417 43 3 493 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Pasteurella multocida (strain Pm70)
Q9K7C3 2.88e-140 416 45 6 500 3 araG L-arabinose transport ATP-binding protein AraG Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9K7C3 3.23e-12 72 26 5 234 3 araG L-arabinose transport ATP-binding protein AraG Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q1J3P2 3.6e-140 416 42 3 493 3 rbsA Ribose import ATP-binding protein RbsA Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q9KSD1 4.98e-140 415 41 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9KSD1 2.96e-11 69 22 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q0S9A4 5.03e-140 415 42 2 496 3 rbsA Ribose import ATP-binding protein RbsA Rhodococcus jostii (strain RHA1)
Q9CM08 1.29e-139 414 41 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Pasteurella multocida (strain Pm70)
Q9CM08 6.27e-15 80 23 3 228 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Pasteurella multocida (strain Pm70)
Q2K0S7 2.22e-139 414 42 2 492 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2K0S7 3.3e-11 69 24 4 229 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q03CA4 3.22e-139 413 44 2 490 3 rbsA Ribose import ATP-binding protein RbsA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q03CA4 5.93e-23 105 28 3 225 3 rbsA Ribose import ATP-binding protein RbsA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q164K3 5.95e-139 413 42 2 491 3 rbsA Ribose import ATP-binding protein RbsA Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q164K3 8.05e-14 77 26 6 229 3 rbsA Ribose import ATP-binding protein RbsA Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q28P50 6.76e-139 413 41 2 493 3 rbsA Ribose import ATP-binding protein RbsA Jannaschia sp. (strain CCS1)
Q28P50 1.58e-15 82 26 3 238 3 rbsA Ribose import ATP-binding protein RbsA Jannaschia sp. (strain CCS1)
Q1M5X4 2.72e-138 411 42 2 492 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1M5X4 2.02e-11 69 22 3 238 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q8D4H4 3.39e-138 410 41 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio vulnificus (strain CMCP6)
Q8D4H4 2.01e-13 75 24 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio vulnificus (strain CMCP6)
Q7MG07 3.78e-138 410 41 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio vulnificus (strain YJ016)
Q7MG07 2.09e-13 75 24 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio vulnificus (strain YJ016)
Q13LX0 6.25e-138 410 41 2 497 3 rbsA Ribose import ATP-binding protein RbsA Paraburkholderia xenovorans (strain LB400)
P44884 2.09e-137 409 42 4 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44884 4.75e-14 78 23 3 228 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QM77 2.09e-137 409 42 4 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Haemophilus influenzae (strain 86-028NP)
Q4QM77 4.75e-14 78 23 3 228 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Haemophilus influenzae (strain 86-028NP)
Q1M360 2.82e-137 409 41 3 494 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1M360 2.4e-20 97 30 5 240 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q9WXX0 1.06e-136 407 43 3 500 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q0B1U4 1.09e-136 407 43 5 503 3 xylG Xylose import ATP-binding protein XylG Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q0B1U4 6.38e-16 84 27 4 230 3 xylG Xylose import ATP-binding protein XylG Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q2SW38 2.51e-136 406 43 5 503 3 xylG Xylose import ATP-binding protein XylG Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2SW38 7.91e-15 80 26 4 230 3 xylG Xylose import ATP-binding protein XylG Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q8NR12 4.49e-136 406 43 4 492 3 rbsA Ribose import ATP-binding protein RbsA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q0I348 4.76e-136 405 43 4 503 3 xylG Xylose import ATP-binding protein XylG Histophilus somni (strain 129Pt)
Q0I348 1.93e-14 79 28 4 230 3 xylG Xylose import ATP-binding protein XylG Histophilus somni (strain 129Pt)
Q398W2 8.35e-136 405 42 3 504 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q8UA86 2.75e-135 404 41 2 491 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8UA86 3.37e-13 75 25 6 240 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q1GHE5 3.08e-134 401 41 5 501 3 rbsA Ribose import ATP-binding protein RbsA Ruegeria sp. (strain TM1040)
Q0B7X0 1.25e-133 399 43 2 502 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q1MBG4 1.4e-133 399 42 5 501 3 araG Arabinose import ATP-binding protein AraG Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q92W56 6.13e-133 397 42 5 502 3 araG Arabinose import ATP-binding protein AraG Rhizobium meliloti (strain 1021)
Q3KDW2 6.21e-133 398 42 5 503 3 xylG Xylose import ATP-binding protein XylG Pseudomonas fluorescens (strain Pf0-1)
Q3KDW2 7.22e-13 74 26 5 246 3 xylG Xylose import ATP-binding protein XylG Pseudomonas fluorescens (strain Pf0-1)
Q987E7 1.11e-132 397 41 4 492 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q987E7 5.4e-15 80 23 3 229 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q1BJW2 3.6e-132 395 43 3 493 3 araG2 Arabinose import ATP-binding protein AraG 2 Burkholderia orbicola (strain AU 1054)
A0B3Z7 3.6e-132 395 43 3 493 3 araG2 Arabinose import ATP-binding protein AraG 2 Burkholderia cenocepacia (strain HI2424)
Q6D4W8 1.57e-131 394 42 3 490 3 araG Arabinose import ATP-binding protein AraG Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D4W8 2.03e-17 88 28 5 245 3 araG Arabinose import ATP-binding protein AraG Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2K204 4.53e-131 393 43 3 496 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2K204 1.89e-20 97 29 4 229 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2K3Y7 1.36e-130 391 42 5 499 3 araG Arabinose import ATP-binding protein AraG Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q4ZTW1 2.62e-130 390 43 5 498 3 araG Arabinose import ATP-binding protein AraG Pseudomonas syringae pv. syringae (strain B728a)
Q1JUP7 3.42e-130 391 43 3 493 3 araG Arabinose import ATP-binding protein AraG Azospirillum brasilense
Q13U53 3.55e-130 390 42 5 505 3 araG Arabinose import ATP-binding protein AraG Paraburkholderia xenovorans (strain LB400)
Q4ZSF3 3.7e-130 390 42 5 501 3 xylG Xylose import ATP-binding protein XylG Pseudomonas syringae pv. syringae (strain B728a)
Q73KK2 4.44e-130 390 40 3 490 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73KK2 8.3e-17 86 24 5 226 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73KK2 1.61e-11 70 24 5 240 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q3JNJ9 4.77e-130 390 43 6 503 3 araG Arabinose import ATP-binding protein AraG Burkholderia pseudomallei (strain 1710b)
Q39BJ8 5.8e-130 390 43 3 493 3 araG2 Arabinose import ATP-binding protein AraG 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q63QQ7 9.03e-130 389 43 6 503 3 araG Arabinose import ATP-binding protein AraG Burkholderia pseudomallei (strain K96243)
Q62GY9 1.15e-129 389 43 6 503 3 araG Arabinose import ATP-binding protein AraG Burkholderia mallei (strain ATCC 23344)
P45046 1.89e-129 388 41 4 501 3 xylG Xylose import ATP-binding protein XylG Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45046 5.94e-15 80 28 4 230 3 xylG Xylose import ATP-binding protein XylG Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q880Z2 1.91e-129 389 41 5 501 3 xylG Xylose import ATP-binding protein XylG Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8U949 3.03e-129 388 40 3 494 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q0B5V4 4.5e-129 388 43 3 494 3 araG2 Arabinose import ATP-binding protein AraG 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q48IS7 4.62e-129 387 43 5 495 3 araG Arabinose import ATP-binding protein AraG Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q1BPL3 6.82e-129 387 43 3 502 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia orbicola (strain AU 1054)
A0B1M7 6.82e-129 387 43 3 502 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia cenocepacia (strain HI2424)
Q48J74 1.29e-128 387 41 5 501 3 xylG Xylose import ATP-binding protein XylG Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q48J74 6.68e-12 71 25 5 246 3 xylG Xylose import ATP-binding protein XylG Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q2SZC2 1.59e-128 386 43 5 496 3 araG1 Arabinose import ATP-binding protein AraG 1 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q882I8 2.75e-128 385 43 5 498 3 araG Arabinose import ATP-binding protein AraG Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9S472 5.07e-128 385 43 6 501 3 araG L-arabinose transport ATP-binding protein AraG Geobacillus stearothermophilus
Q9S472 3.85e-13 75 26 7 254 3 araG L-arabinose transport ATP-binding protein AraG Geobacillus stearothermophilus
Q39JR1 5.24e-128 385 42 5 496 3 araG1 Arabinose import ATP-binding protein AraG 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q92UI2 6.5e-128 384 42 3 487 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium meliloti (strain 1021)
Q92UI2 2.14e-20 97 29 5 227 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium meliloti (strain 1021)
Q1BZA2 8.72e-128 384 42 5 496 3 araG1 Arabinose import ATP-binding protein AraG 1 Burkholderia orbicola (strain AU 1054)
A0K4E8 8.72e-128 384 42 5 496 3 araG1 Arabinose import ATP-binding protein AraG 1 Burkholderia cenocepacia (strain HI2424)
Q3K8M7 7.26e-127 382 42 3 493 3 araG Arabinose import ATP-binding protein AraG Pseudomonas fluorescens (strain Pf0-1)
Q3K8M7 1.71e-16 85 26 4 224 3 araG Arabinose import ATP-binding protein AraG Pseudomonas fluorescens (strain Pf0-1)
Q56342 1.3e-126 381 40 3 491 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema pallidum (strain Nichols)
Q56342 1.73e-15 82 24 4 229 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema pallidum (strain Nichols)
Q56342 5.33e-09 62 22 5 238 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema pallidum (strain Nichols)
Q8XVS2 2.82e-126 380 42 5 499 3 araG Arabinose import ATP-binding protein AraG Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8XVS2 2.17e-13 75 27 4 229 3 araG Arabinose import ATP-binding protein AraG Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q0BIE1 5.39e-126 379 41 5 496 3 araG1 Arabinose import ATP-binding protein AraG 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q2T4S8 1.64e-125 379 42 3 494 3 araG2 Arabinose import ATP-binding protein AraG 2 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2SVU4 5.15e-125 377 41 2 503 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
P32721 2.83e-124 375 40 7 507 3 alsA D-allose import ATP-binding protein AlsA Escherichia coli (strain K12)
Q66AF5 1.18e-121 369 41 3 490 3 araG Arabinose import ATP-binding protein AraG Yersinia pseudotuberculosis serotype I (strain IP32953)
Q66AF5 3.96e-15 81 28 6 239 3 araG Arabinose import ATP-binding protein AraG Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CIX6 1.18e-121 369 41 3 490 3 araG Arabinose import ATP-binding protein AraG Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CIX6 3.96e-15 81 28 6 239 3 araG Arabinose import ATP-binding protein AraG Yersinia pestis bv. Antiqua (strain Nepal516)
Q0WER5 1.18e-121 369 41 3 490 3 araG Arabinose import ATP-binding protein AraG Yersinia pestis
Q0WER5 3.96e-15 81 28 6 239 3 araG Arabinose import ATP-binding protein AraG Yersinia pestis
Q1C7J0 1.18e-121 369 41 3 490 3 araG Arabinose import ATP-binding protein AraG Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C7J0 3.96e-15 81 28 6 239 3 araG Arabinose import ATP-binding protein AraG Yersinia pestis bv. Antiqua (strain Antiqua)
Q88J90 1.77e-121 368 40 6 497 3 rbsA Ribose import ATP-binding protein RbsA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88J90 5.5e-17 87 26 6 230 3 rbsA Ribose import ATP-binding protein RbsA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q322L1 1.09e-120 366 40 6 497 3 araG Arabinose import ATP-binding protein AraG Shigella boydii serotype 4 (strain Sb227)
P0AAF3 2.25e-120 365 40 6 497 1 araG Arabinose import ATP-binding protein AraG Escherichia coli (strain K12)
P0AAF4 2.25e-120 365 40 6 497 3 araG Arabinose import ATP-binding protein AraG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAF5 2.25e-120 365 40 6 497 3 araG Arabinose import ATP-binding protein AraG Escherichia coli O157:H7
Q1RAN8 4.04e-120 364 39 6 497 3 araG Arabinose import ATP-binding protein AraG Escherichia coli (strain UTI89 / UPEC)
Q32HC7 4.96e-120 364 39 6 497 3 araG Arabinose import ATP-binding protein AraG Shigella dysenteriae serotype 1 (strain Sd197)
Q3Z2S7 9.8e-120 363 39 6 497 3 araG Arabinose import ATP-binding protein AraG Shigella sonnei (strain Ss046)
Q0TGT7 2.3e-119 362 39 6 497 3 araG Arabinose import ATP-binding protein AraG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q83KP2 7.23e-119 361 39 6 497 3 araG Arabinose import ATP-binding protein AraG Shigella flexneri
Q11C01 2.52e-118 360 40 5 494 3 rbsA Ribose import ATP-binding protein RbsA Chelativorans sp. (strain BNC1)
Q11C01 8.83e-20 95 28 6 243 3 rbsA Ribose import ATP-binding protein RbsA Chelativorans sp. (strain BNC1)
Q62K91 1.76e-116 355 40 2 506 3 rbsA Ribose import ATP-binding protein RbsA Burkholderia mallei (strain ATCC 23344)
P63299 4.5e-116 354 37 4 496 3 ytfR Galactofuranose transporter ATP-binding protein YtfR Escherichia coli O157:H7
P63299 2.13e-18 91 28 3 228 3 ytfR Galactofuranose transporter ATP-binding protein YtfR Escherichia coli O157:H7
Q8G847 6.06e-116 354 40 5 473 1 fruK Fructose import ATP-binding protein FruK Bifidobacterium longum (strain NCC 2705)
Q8G847 6.84e-17 87 25 2 224 1 fruK Fructose import ATP-binding protein FruK Bifidobacterium longum (strain NCC 2705)
Q6BEX0 6.15e-116 353 37 4 496 1 ytfR Galactofuranose transporter ATP-binding protein YtfR Escherichia coli (strain K12)
Q6BEX0 2.19e-18 91 28 3 228 1 ytfR Galactofuranose transporter ATP-binding protein YtfR Escherichia coli (strain K12)
Q92MP8 8.35e-112 343 40 6 497 3 R02565 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium meliloti (strain 1021)
Q92MP8 1.61e-19 94 29 5 230 3 R02565 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium meliloti (strain 1021)
Q92MP8 9.62e-13 73 27 4 209 3 R02565 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium meliloti (strain 1021)
Q3JSI8 4.24e-111 352 40 2 506 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia pseudomallei (strain 1710b)
Q3J3V9 3.63e-110 339 37 5 494 3 rbsA Ribose import ATP-binding protein RbsA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q3J3V9 1.17e-15 83 26 5 228 3 rbsA Ribose import ATP-binding protein RbsA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q3J3V9 1.13e-11 70 25 7 236 3 rbsA Ribose import ATP-binding protein RbsA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q1MHS1 5.11e-109 336 37 7 498 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1MHS1 5.37e-14 77 23 2 229 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q7N2D9 5.97e-108 333 38 7 506 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7N2D9 2.37e-14 79 25 7 239 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q1QYT1 2.21e-107 332 38 6 495 3 araG Arabinose import ATP-binding protein AraG Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q98K15 7.33e-106 328 38 6 496 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q98K15 9.41e-16 83 25 2 217 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q2PBM0 1.17e-105 327 38 6 507 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus luminescens
Q2PBM0 6.14e-15 80 26 8 251 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus luminescens
Q2K9A3 1.16e-102 320 37 7 498 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2K9A3 1.61e-13 76 22 2 229 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
O05253 1.24e-101 317 36 5 513 1 nupO Guanosine import ATP-binding protein NupO Bacillus subtilis (strain 168)
Q2PBM3 2.02e-99 311 37 10 507 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus temperata
Q2PBM3 3.5e-15 81 27 6 232 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus temperata
A4TQL5 2.13e-98 309 37 5 511 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis (strain Pestoides F)
A4TQL5 8.64e-13 74 24 6 236 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis (strain Pestoides F)
Q1CN15 2.13e-98 309 37 5 511 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CN15 8.64e-13 74 24 6 236 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R074 2.13e-98 309 37 5 511 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis bv. Antiqua (strain Angola)
A9R074 8.64e-13 74 24 6 236 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis bv. Antiqua (strain Angola)
Q0WJP9 2.13e-98 309 37 5 511 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis
Q0WJP9 8.64e-13 74 24 6 236 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis
Q1C138 2.13e-98 309 37 5 511 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C138 8.64e-13 74 24 6 236 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis bv. Antiqua (strain Antiqua)
Q66EY9 5.77e-98 308 37 5 507 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K3G1 5.77e-98 308 37 5 507 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B1JLQ0 6.42e-98 308 37 5 507 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FMJ7 1.05e-97 307 37 5 507 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JJ55 6.23e-97 305 37 8 509 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A6TEB8 1.98e-94 298 37 9 508 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A4WER4 2.05e-94 298 37 8 507 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Enterobacter sp. (strain 638)
P77509 1.28e-93 296 36 8 488 3 yphE Uncharacterized ABC transporter ATP-binding protein YphE Escherichia coli (strain K12)
P77509 4.43e-15 81 24 4 234 3 yphE Uncharacterized ABC transporter ATP-binding protein YphE Escherichia coli (strain K12)
P77257 5.99e-93 295 37 7 503 1 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain K12)
B1XEA1 5.99e-93 295 37 7 503 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain K12 / DH10B)
B1IRU7 5.98e-92 292 36 7 503 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8XAY7 6.45e-92 292 36 7 503 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli O157:H7
Q8Z2X5 1.41e-91 291 35 8 509 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella typhi
B1LFA2 1.55e-91 291 37 7 503 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain SMS-3-5 / SECEC)
Q8ZKQ4 4.87e-91 290 35 8 509 1 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0C886 5.9e-91 290 35 8 509 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella choleraesuis (strain SC-B67)
A9MZG1 6.85e-91 289 35 8 509 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJE7 6.85e-91 289 35 8 509 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q0T4L9 7.63e-91 289 36 7 503 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Shigella flexneri serotype 5b (strain 8401)
Q83L12 8.49e-91 289 36 7 503 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Shigella flexneri
A8A066 1.59e-90 288 36 7 503 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli O9:H4 (strain HS)
D4GPW3 1.1e-88 285 33 7 522 3 tsgD13 Glucose import ATP-binding protein TsgD13 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
D4GPW3 5.32e-14 78 25 5 254 3 tsgD13 Glucose import ATP-binding protein TsgD13 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
D4GPW3 1.8e-13 76 23 7 252 3 tsgD13 Glucose import ATP-binding protein TsgD13 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
A2RKA7 7.49e-85 273 33 6 502 1 nupA Nucleoside import ATP-binding protein NupA Lactococcus lactis subsp. cremoris (strain MG1363)
A2RKA7 6.37e-14 77 28 2 224 1 nupA Nucleoside import ATP-binding protein NupA Lactococcus lactis subsp. cremoris (strain MG1363)
P55570 2.01e-72 241 32 12 494 3 NGR_a02480 Uncharacterized ABC transporter ATP-binding protein y4mK Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P47365 1.09e-54 195 28 16 549 3 MG119 Putative carbohydrate transport ATP-binding protein MG119 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P47365 1.11e-13 77 26 4 246 3 MG119 Putative carbohydrate transport ATP-binding protein MG119 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
A7ZLX1 5.77e-52 182 37 4 309 5 lsrA Putative autoinducer 2 import ATP-binding protein LsrA homolog Escherichia coli O139:H28 (strain E24377A / ETEC)
A7ZLX1 4.12e-16 82 26 4 223 5 lsrA Putative autoinducer 2 import ATP-binding protein LsrA homolog Escherichia coli O139:H28 (strain E24377A / ETEC)
P0DTT6 1.43e-45 162 38 2 238 1 xylG Xylose/arabinose import ATP-binding protein XylG Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
P0DTT6 3.4e-18 87 27 5 232 1 xylG Xylose/arabinose import ATP-binding protein XylG Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q9F9B0 7.27e-43 155 37 2 225 1 frcA Fructose import ATP-binding protein FrcA Rhizobium meliloti
Q9F9B0 1.18e-23 103 33 6 222 1 frcA Fructose import ATP-binding protein FrcA Rhizobium meliloti
P75516 9.46e-41 157 35 4 271 3 MPN_258 Putative carbohydrate transport ATP-binding protein MPN_258 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P75516 5.19e-19 93 31 5 209 3 MPN_258 Putative carbohydrate transport ATP-binding protein MPN_258 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P75516 7.48e-13 74 23 5 255 3 MPN_258 Putative carbohydrate transport ATP-binding protein MPN_258 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q8G838 3.16e-35 143 26 15 503 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8TQW9 6.4e-31 129 25 17 503 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQW9 3.08e-15 81 26 4 225 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q81CT8 5.65e-29 123 26 18 533 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81CT8 8.21e-19 93 29 5 234 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81CT8 8.5e-07 55 23 7 225 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q9CM47 9.31e-29 123 34 6 247 3 macB Macrolide export ATP-binding/permease protein MacB Pasteurella multocida (strain Pm70)
Q9CM47 3.17e-10 66 26 11 232 3 macB Macrolide export ATP-binding/permease protein MacB Pasteurella multocida (strain Pm70)
Q8PUE7 9.87e-28 119 24 19 502 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PUE7 8.8e-14 77 25 4 224 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q897I2 1.62e-27 118 27 12 422 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q897I2 2.57e-12 72 25 5 226 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q897I2 3.76e-07 56 30 1 93 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
P45073 2.42e-27 113 26 2 242 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45073 2.25e-17 85 26 6 238 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q73R11 2.53e-27 118 22 12 515 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73P93 3.83e-27 117 22 13 493 3 TDE_0906 Putative ABC transporter ATP-binding protein TDE_0906 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q8YUV1 3.98e-27 113 30 4 255 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8YUV1 4.54e-09 60 25 6 236 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P46903 1.08e-26 111 33 6 207 1 natA ABC transporter ATP-binding protein NatA Bacillus subtilis (strain 168)
P46903 1.08e-17 85 28 3 214 1 natA ABC transporter ATP-binding protein NatA Bacillus subtilis (strain 168)
Q58663 1.26e-26 111 29 4 250 1 livG Probable branched-chain amino acid transport ATP-binding protein LivG Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q58663 1.2e-15 80 28 3 216 1 livG Probable branched-chain amino acid transport ATP-binding protein LivG Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8ES39 1.87e-26 115 25 14 482 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8ES39 1.23e-11 70 24 4 238 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8ES39 6.17e-10 65 27 7 216 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q83LR7 2.13e-26 116 32 5 231 3 macB Macrolide export ATP-binding/permease protein MacB Shigella flexneri
Q83LR7 1.01e-13 77 27 11 237 3 macB Macrolide export ATP-binding/permease protein MacB Shigella flexneri
Q44848 2.4e-26 115 23 14 507 3 BB_0318 Uncharacterized ABC transporter ATP-binding protein BB_0318 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q6HI76 3.09e-26 115 24 21 527 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HI76 2.85e-18 91 28 4 225 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HI76 6.43e-11 68 26 7 219 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81PZ8 6.19e-26 114 24 21 527 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q81PZ8 1.69e-18 92 28 4 225 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q81PZ8 1.32e-10 67 26 7 219 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
P0A9S9 1.87e-25 108 29 6 230 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Shigella flexneri
P0A9S9 1.68e-13 73 27 7 230 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Shigella flexneri
P0A9S7 1.87e-25 108 29 6 230 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Escherichia coli (strain K12)
P0A9S7 1.68e-13 73 27 7 230 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Escherichia coli (strain K12)
P0A9S8 1.87e-25 108 29 6 230 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Escherichia coli O157:H7
P0A9S8 1.68e-13 73 27 7 230 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Escherichia coli O157:H7
P10346 1.96e-25 107 33 4 203 1 glnQ Glutamine transport ATP-binding protein GlnQ Escherichia coli (strain K12)
P10346 5.56e-12 69 24 5 221 1 glnQ Glutamine transport ATP-binding protein GlnQ Escherichia coli (strain K12)
Q8XED0 2.85e-25 113 32 5 231 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O157:H7
Q8XED0 1.93e-12 73 26 10 242 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O157:H7
Q0C1C3 2.91e-25 107 31 5 228 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Hyphomonas neptunium (strain ATCC 15444)
Q0C1C3 1.09e-07 56 38 2 81 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Hyphomonas neptunium (strain ATCC 15444)
Q8ZQE4 4.03e-25 112 31 4 245 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZQE4 2.57e-14 79 26 10 248 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z824 4.07e-25 112 31 4 245 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhi
Q8Z824 2.73e-14 79 26 10 248 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhi
Q5PGK9 4.22e-25 112 31 4 245 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PGK9 2.9e-14 79 26 10 248 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A0KMJ3 4.56e-25 112 31 5 235 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A0KMJ3 4.33e-10 65 26 8 215 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q32DZ9 6.74e-25 112 32 5 231 3 macB Macrolide export ATP-binding/permease protein MacB Shigella dysenteriae serotype 1 (strain Sd197)
Q32DZ9 9.28e-13 74 26 10 236 3 macB Macrolide export ATP-binding/permease protein MacB Shigella dysenteriae serotype 1 (strain Sd197)
Q323M3 8.19e-25 111 32 5 231 3 macB Macrolide export ATP-binding/permease protein MacB Shigella boydii serotype 4 (strain Sb227)
Q323M3 2.06e-12 73 26 10 242 3 macB Macrolide export ATP-binding/permease protein MacB Shigella boydii serotype 4 (strain Sb227)
A1K323 8.99e-25 111 31 5 233 3 macB Macrolide export ATP-binding/permease protein MacB Azoarcus sp. (strain BH72)
A1K323 9.51e-13 74 30 9 214 3 macB Macrolide export ATP-binding/permease protein MacB Azoarcus sp. (strain BH72)
P75831 1.29e-24 111 31 5 231 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain K12)
P75831 3.29e-13 75 26 10 242 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain K12)
Q57R58 1.45e-24 110 31 4 245 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella choleraesuis (strain SC-B67)
Q57R58 2.41e-14 79 26 10 248 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella choleraesuis (strain SC-B67)
Q3Z3Q4 1.56e-24 110 31 5 231 3 macB Macrolide export ATP-binding/permease protein MacB Shigella sonnei (strain Ss046)
Q3Z3Q4 3.37e-13 75 26 10 242 3 macB Macrolide export ATP-binding/permease protein MacB Shigella sonnei (strain Ss046)
Q1RE44 1.61e-24 110 31 5 231 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain UTI89 / UPEC)
Q1RE44 3.68e-13 75 26 10 242 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain UTI89 / UPEC)
A1A9B7 1.61e-24 110 31 5 231 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Escherichia coli O1:K1 / APEC
A1A9B7 3.68e-13 75 26 10 242 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Escherichia coli O1:K1 / APEC
Q0TJH0 1.68e-24 110 31 5 231 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TJH0 3.68e-13 75 26 10 236 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q6G2E2 2.48e-24 107 28 6 290 3 metN Methionine import ATP-binding protein MetN Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q6G2E2 3.95e-13 73 29 7 219 3 metN Methionine import ATP-binding protein MetN Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q12B04 2.72e-24 107 32 5 229 3 metN Methionine import ATP-binding protein MetN Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q12B04 3.35e-12 71 30 7 208 3 metN Methionine import ATP-binding protein MetN Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q1BY14 4.86e-24 106 32 4 226 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia orbicola (strain AU 1054)
Q1BY14 4.19e-15 80 28 5 214 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia orbicola (strain AU 1054)
A0K5N5 4.86e-24 106 32 4 226 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia cenocepacia (strain HI2424)
A0K5N5 4.19e-15 80 28 5 214 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia cenocepacia (strain HI2424)
Q4K9A4 5.24e-24 109 31 4 231 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4K9A4 3.67e-08 59 26 9 214 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1IGZ0 5.37e-24 106 30 7 236 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas entomophila (strain L48)
Q1IGZ0 1.08e-11 69 24 4 214 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas entomophila (strain L48)
Q73P71 5.93e-24 104 30 8 245 3 phnC Phosphonates import ATP-binding protein PhnC Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73P71 8.9e-13 71 25 6 225 3 phnC Phosphonates import ATP-binding protein PhnC Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q7CJG3 6.44e-24 108 31 4 235 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis
Q7CJG3 7.32e-11 68 25 8 213 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis
Q1C5W7 6.44e-24 108 31 4 235 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C5W7 7.32e-11 68 25 8 213 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis bv. Antiqua (strain Antiqua)
Q1CJW8 6.44e-24 108 31 4 235 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CJW8 7.32e-11 68 25 8 213 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Yersinia pestis bv. Antiqua (strain Nepal516)
Q668L6 6.49e-24 108 31 4 235 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q668L6 7.32e-11 68 25 8 213 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q7UPK3 7.27e-24 103 37 9 221 3 lolD2 Lipoprotein-releasing system ATP-binding protein LolD 2 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q7UPK3 1.13e-06 53 36 3 88 3 lolD2 Lipoprotein-releasing system ATP-binding protein LolD 2 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A1U0A9 9.33e-24 108 34 5 204 3 macB Macrolide export ATP-binding/permease protein MacB Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A1U0A9 3.95e-09 62 25 8 227 3 macB Macrolide export ATP-binding/permease protein MacB Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q7M8U0 1.04e-23 108 34 5 222 3 macB Macrolide export ATP-binding/permease protein MacB Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q7M8U0 2.98e-11 69 28 9 239 3 macB Macrolide export ATP-binding/permease protein MacB Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q9MUN1 1.04e-23 105 30 3 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
Q9MUN1 6.5e-10 64 23 6 210 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
P56344 1.06e-23 102 29 3 215 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
P56344 2.7e-10 63 24 6 207 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
Q8KLG1 1.19e-23 104 30 4 220 3 nodI Nod factor export ATP-binding protein I Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8KLG1 4.62e-17 85 27 7 224 3 nodI Nod factor export ATP-binding protein I Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q1LQB5 1.28e-23 103 30 7 252 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q1LQB5 7.82e-07 54 23 7 230 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q39IE7 1.28e-23 105 32 4 226 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q39IE7 4.56e-14 77 28 5 214 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q7VI92 1.95e-23 104 30 5 223 3 metN Methionine import ATP-binding protein MetN Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q7VI92 1.02e-09 63 24 6 211 3 metN Methionine import ATP-binding protein MetN Helicobacter hepaticus (strain ATCC 51449 / 3B1)
P37624 2.79e-23 107 25 18 499 1 rbbA Ribosome-associated ATPase Escherichia coli (strain K12)
P37624 1.67e-10 67 24 5 246 1 rbbA Ribosome-associated ATPase Escherichia coli (strain K12)
Q6RCE0 2.84e-23 102 30 7 251 3 phnC Phosphonates import ATP-binding protein PhnC Stutzerimonas stutzeri
Q6RCE0 9.88e-07 53 21 6 228 3 phnC Phosphonates import ATP-binding protein PhnC Stutzerimonas stutzeri
Q9ZJ34 3e-23 103 29 5 223 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain J99 / ATCC 700824)
Q9ZJ34 3.91e-07 55 24 5 211 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain J99 / ATCC 700824)
Q0BH79 3.13e-23 103 32 5 226 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q0BH79 1.19e-16 84 30 5 214 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q88RL5 3.24e-23 103 30 6 235 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88RL5 2.54e-11 68 25 5 220 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8DIA0 3.91e-23 103 30 3 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8DIA0 4.92e-11 67 25 9 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q9AB70 4.05e-23 102 28 7 265 3 phnC Phosphonates import ATP-binding protein PhnC Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9AB70 3.46e-10 64 22 4 223 3 phnC Phosphonates import ATP-binding protein PhnC Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q97KD5 4.29e-23 103 28 4 250 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q97KD5 1.53e-12 72 29 7 226 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8F6Z1 4.6e-23 103 28 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q8F6Z1 1.81e-13 75 25 6 211 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PE5 4.6e-23 103 28 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q72PE5 1.81e-13 75 25 6 211 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q5M5Z2 5.04e-23 103 28 12 341 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M5Z2 4.93e-13 73 27 6 240 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q8Z0H0 5.59e-23 103 30 3 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8Z0H0 4.32e-11 67 25 8 225 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
O28881 6.42e-23 101 25 4 245 3 livG Probable branched-chain amino acid transport ATP-binding protein LivG Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O28881 4.53e-09 60 25 5 221 3 livG Probable branched-chain amino acid transport ATP-binding protein LivG Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q3KK97 6.59e-23 102 30 5 233 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain Pf0-1)
Q3KK97 2.11e-12 71 27 6 224 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain Pf0-1)
O26096 6.85e-23 102 29 5 223 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain ATCC 700392 / 26695)
O26096 2.43e-07 56 24 5 211 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain ATCC 700392 / 26695)
Q46Y69 7.06e-23 103 29 5 254 3 metN Methionine import ATP-binding protein MetN Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q46Y69 3.77e-13 74 29 7 214 3 metN Methionine import ATP-binding protein MetN Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q1LQF6 7.06e-23 103 30 4 224 3 metN Methionine import ATP-binding protein MetN Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q1LQF6 3.95e-13 73 28 6 211 3 metN Methionine import ATP-binding protein MetN Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q1CR30 7.12e-23 102 29 5 223 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain HPAG1)
Q1CR30 2.37e-07 56 24 5 211 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain HPAG1)
Q9A502 7.84e-23 102 30 4 220 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9A502 2.8e-17 86 30 5 210 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q5M1F6 1e-22 102 28 13 341 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain CNRZ 1066)
Q5M1F6 3.37e-13 74 27 5 237 3 metN Methionine import ATP-binding protein MetN Streptococcus thermophilus (strain CNRZ 1066)
Q1J8E4 1.02e-22 102 32 6 237 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1J8E4 8.07e-17 85 31 5 209 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q8UA73 1.05e-22 102 29 4 217 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8UA73 3.36e-13 74 24 6 220 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q0SFY5 1.09e-22 102 30 4 243 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodococcus jostii (strain RHA1)
Q0SFY5 4.76e-13 73 28 6 219 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodococcus jostii (strain RHA1)
Q1GIE5 1.12e-22 102 33 5 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Ruegeria sp. (strain TM1040)
Q1GIE5 1.41e-13 75 24 3 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Ruegeria sp. (strain TM1040)
Q0ASQ1 1.28e-22 100 28 6 248 3 phnC Phosphonates import ATP-binding protein PhnC Maricaulis maris (strain MCS10)
Q0ASQ1 9.08e-10 63 25 8 234 3 phnC Phosphonates import ATP-binding protein PhnC Maricaulis maris (strain MCS10)
Q0KDG3 1.3e-22 102 31 4 224 3 metN Methionine import ATP-binding protein MetN Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q0KDG3 2.41e-13 74 29 7 218 3 metN Methionine import ATP-binding protein MetN Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q93DX8 1.31e-22 100 27 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q93DX8 3.78e-12 70 26 6 219 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q3YUN6 1.38e-22 100 28 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Shigella sonnei (strain Ss046)
Q3YUN6 3.75e-12 70 22 7 232 3 phnC Phosphonates import ATP-binding protein PhnC Shigella sonnei (strain Ss046)
Q5NHP2 1.39e-22 99 29 5 222 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q5NHP2 1.7e-05 49 26 7 199 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q2A4V5 1.39e-22 99 29 5 222 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Francisella tularensis subsp. holarctica (strain LVS)
Q2A4V5 1.7e-05 49 26 7 199 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Francisella tularensis subsp. holarctica (strain LVS)
Q14J44 1.39e-22 99 29 5 222 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Francisella tularensis subsp. tularensis (strain FSC 198)
Q14J44 1.7e-05 49 26 7 199 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Francisella tularensis subsp. tularensis (strain FSC 198)
Q9K876 1.52e-22 102 28 2 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9K876 3.01e-15 80 27 7 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q17VE0 1.58e-22 101 28 4 221 3 metN Methionine import ATP-binding protein MetN Helicobacter acinonychis (strain Sheeba)
Q17VE0 1.43e-07 57 24 5 211 3 metN Methionine import ATP-binding protein MetN Helicobacter acinonychis (strain Sheeba)
Q329I3 1.67e-22 100 29 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Shigella dysenteriae serotype 1 (strain Sd197)
Q329I3 1.99e-11 67 24 8 220 3 phnC Phosphonates import ATP-binding protein PhnC Shigella dysenteriae serotype 1 (strain Sd197)
Q8PC11 1.67e-22 102 29 4 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8PC11 1.02e-12 72 24 6 229 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4KKK8 1.75e-22 101 29 5 233 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4KKK8 5.6e-11 67 26 6 219 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q93DA2 1.8e-22 102 30 5 236 3 metN Methionine import ATP-binding protein MetN Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q93DA2 4.45e-12 70 25 7 243 3 metN Methionine import ATP-binding protein MetN Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q6F9P2 1.82e-22 101 31 6 228 3 metN2 Methionine import ATP-binding protein MetN 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q6F9P2 1.8e-12 72 25 5 219 3 metN2 Methionine import ATP-binding protein MetN 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q0BN75 1.9e-22 99 29 5 222 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Francisella tularensis subsp. holarctica (strain OSU18)
Q0BN75 8.82e-06 50 26 7 199 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Francisella tularensis subsp. holarctica (strain OSU18)
Q0T9T7 2.11e-22 99 28 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0T9T7 5.87e-12 69 22 7 232 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q7NIW1 2.47e-22 101 28 3 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q7NIW1 2.92e-10 65 23 7 221 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q21XK2 2.47e-22 101 30 4 229 3 metN Methionine import ATP-binding protein MetN Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q21XK2 3.59e-10 65 27 5 208 3 metN Methionine import ATP-binding protein MetN Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q8UCD5 2.53e-22 101 29 3 197 3 modC Molybdenum import ATP-binding protein ModC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8UCD5 1.11e-14 79 26 9 221 3 modC Molybdenum import ATP-binding protein ModC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q669P3 3.03e-22 98 33 5 206 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pseudotuberculosis serotype I (strain IP32953)
Q669P3 5.54e-09 60 25 7 217 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1R3F6 3.14e-22 99 28 4 232 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain UTI89 / UPEC)
Q1R3F6 8.44e-12 68 23 7 220 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain UTI89 / UPEC)
Q2P7S3 3.16e-22 100 29 5 233 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q2P7S3 3.33e-11 68 26 7 209 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q1CI46 3.21e-22 98 33 5 206 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CI46 9.08e-09 59 24 7 217 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZFR4 3.21e-22 98 33 5 206 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis
Q8ZFR4 9.08e-09 59 24 7 217 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis
Q1C6Q8 3.21e-22 98 33 5 206 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C6Q8 9.08e-09 59 24 7 217 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis bv. Antiqua (strain Antiqua)
Q1I7I9 3.23e-22 103 31 4 231 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas entomophila (strain L48)
Q1I7I9 1.2e-09 64 27 10 222 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas entomophila (strain L48)
Q5WVL8 3.33e-22 100 29 4 249 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Lens)
Q5WVL8 1.79e-13 75 30 8 221 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Lens)
Q5H503 3.58e-22 100 29 5 233 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q5H503 4.3e-11 67 27 9 212 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
P16677 3.63e-22 99 28 6 237 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain K12)
P16677 1.83e-11 68 22 7 232 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain K12)
Q8FAV1 3.7e-22 99 28 4 232 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FAV1 9.27e-12 68 23 6 214 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A193 3.8e-22 99 29 7 230 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A193 1.6e-13 73 28 7 220 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A194 3.8e-22 99 29 7 230 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Salmonella typhi
P0A194 1.6e-13 73 28 7 220 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Salmonella typhi
Q5X484 4.51e-22 100 29 4 249 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Paris)
Q5X484 1.8e-13 75 30 8 221 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Paris)
Q46TK4 4.61e-22 99 28 7 253 3 phnC Phosphonates import ATP-binding protein PhnC Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q46TK4 1.19e-05 50 21 8 232 3 phnC Phosphonates import ATP-binding protein PhnC Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q609Q1 4.89e-22 100 29 3 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q609Q1 8.68e-13 73 26 7 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q9TKX3 5.21e-22 100 28 3 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nephroselmis olivacea
Q9TKX3 8.73e-12 70 25 5 204 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nephroselmis olivacea
P94440 5.34e-22 99 29 6 240 1 lnrL Linearmycin resistance ATP-binding protein LnrL Bacillus subtilis (strain 168)
P94440 5.66e-16 82 27 5 203 1 lnrL Linearmycin resistance ATP-binding protein LnrL Bacillus subtilis (strain 168)
Q5ZUG5 5.73e-22 100 29 4 249 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5ZUG5 1.3e-13 75 30 8 221 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q3A9G5 6.06e-22 100 28 4 228 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q3A9G5 1.77e-15 81 27 8 251 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q8RQL7 6.38e-22 98 27 2 218 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8RQL7 6.77e-13 72 25 5 211 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8XK20 6.52e-22 102 32 11 260 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8XK20 1.1e-21 102 23 17 552 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8E3S0 6.66e-22 100 31 4 235 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype III (strain NEM316)
Q8E3S0 3.62e-13 74 27 4 213 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype III (strain NEM316)
Q39GT7 6.91e-22 99 28 3 228 3 nodI Nod factor export ATP-binding protein I Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q39GT7 1.25e-16 84 28 4 207 3 nodI Nod factor export ATP-binding protein I Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q8DY54 6.92e-22 100 31 4 235 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8DY54 4.93e-13 73 27 4 213 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3JZP8 6.92e-22 100 31 4 235 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q3JZP8 4.93e-13 73 27 4 213 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q98G43 7.8e-22 100 30 5 222 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q98G43 2.25e-11 68 25 7 217 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A0A0H2ZLL3 7.9e-22 97 30 5 220 3 egtUA Probable ergothioneine transport ATP-binding protein EgtUA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A0A0H2ZLL3 2.8e-15 79 28 7 211 3 egtUA Probable ergothioneine transport ATP-binding protein EgtUA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q92WJ0 8.03e-22 100 28 3 225 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhizobium meliloti (strain 1021)
Q92WJ0 4.22e-14 77 27 7 211 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhizobium meliloti (strain 1021)
Q6WB63 8.5e-22 98 29 5 245 3 phnC Phosphonates import ATP-binding protein PhnC Alcaligenes faecalis
Q6WB63 1.84e-09 62 24 7 257 3 phnC Phosphonates import ATP-binding protein PhnC Alcaligenes faecalis
Q48PU6 8.69e-22 99 29 6 233 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q48PU6 1.61e-11 68 26 5 211 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZZR8 8.95e-22 99 29 6 233 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. syringae (strain B728a)
Q4ZZR8 2.4e-11 68 24 5 216 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. syringae (strain B728a)
Q8RI39 9.18e-22 100 31 5 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8RI39 2.89e-15 80 26 5 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
P0C0E2 9.44e-22 97 31 3 220 3 srtF Lantibiotic transport ATP-binding protein SrtF Streptococcus pyogenes
P0C0E2 2.44e-14 75 28 4 210 3 srtF Lantibiotic transport ATP-binding protein SrtF Streptococcus pyogenes
P0C0E3 9.44e-22 97 31 3 220 3 srtF Lantibiotic transport ATP-binding protein SrtF Streptococcus pyogenes serotype M1
P0C0E3 2.44e-14 75 28 4 210 3 srtF Lantibiotic transport ATP-binding protein SrtF Streptococcus pyogenes serotype M1
Q87UN4 1.06e-21 99 29 6 233 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q87UN4 3.52e-11 68 24 5 216 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88F88 1.13e-21 102 31 4 228 1 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88F88 6.71e-09 62 26 10 222 1 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q03Z27 1.16e-21 99 30 6 236 3 metN Methionine import ATP-binding protein MetN Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q03Z27 7.25e-17 85 29 4 210 3 metN Methionine import ATP-binding protein MetN Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q02QM1 1.19e-21 98 30 7 252 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q02QM1 2.22e-05 49 22 8 244 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9I6L0 1.26e-21 99 26 2 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9I6L0 7.62e-12 70 26 6 209 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q89UD2 1.27e-21 99 26 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q89UD2 2.24e-13 74 27 7 218 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P36879 1.29e-21 98 27 6 242 1 yadG Uncharacterized ABC transporter ATP-binding protein YadG Escherichia coli (strain K12)
P36879 1.69e-08 59 34 0 84 1 yadG Uncharacterized ABC transporter ATP-binding protein YadG Escherichia coli (strain K12)
Q7NQN5 1.32e-21 99 30 4 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7NQN5 4.75e-17 86 27 5 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q6D2F6 1.35e-21 99 31 5 220 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D2F6 9.35e-16 82 26 5 208 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q1JNE0 1.45e-21 99 30 5 237 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JNE0 1.1e-16 85 29 6 236 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JDG6 1.45e-21 99 30 5 237 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q1JDG6 1.1e-16 85 29 6 236 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7N6Z2 1.54e-21 99 29 4 219 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7N6Z2 8.18e-16 82 27 6 208 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8PNN4 1.58e-21 99 27 3 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas axonopodis pv. citri (strain 306)
Q8PNN4 1.06e-10 66 23 5 207 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas axonopodis pv. citri (strain 306)
Q6D664 1.62e-21 96 29 5 228 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D664 5.52e-10 63 24 8 222 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q5XDS8 1.66e-21 99 30 5 237 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q5XDS8 7.29e-17 85 31 5 209 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q1B677 1.76e-21 99 27 5 265 3 metN Methionine import ATP-binding protein MetN Mycobacterium sp. (strain MCS)
Q1B677 5.58e-14 76 31 5 216 3 metN Methionine import ATP-binding protein MetN Mycobacterium sp. (strain MCS)
Q83P97 1.76e-21 97 28 6 237 3 phnC Phosphonates import ATP-binding protein PhnC Shigella flexneri
Q83P97 8.93e-12 68 23 7 220 3 phnC Phosphonates import ATP-binding protein PhnC Shigella flexneri
Q0SXV5 1.76e-21 97 28 6 237 3 phnC Phosphonates import ATP-binding protein PhnC Shigella flexneri serotype 5b (strain 8401)
Q0SXV5 8.93e-12 68 23 7 220 3 phnC Phosphonates import ATP-binding protein PhnC Shigella flexneri serotype 5b (strain 8401)
Q5FA19 1.77e-21 99 30 3 222 1 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q5FA19 1.43e-14 78 29 8 231 1 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
P37774 1.78e-21 97 28 3 232 1 tcyN L-cystine transport system ATP-binding protein TcyN Escherichia coli (strain K12)
P37774 1.24e-11 68 41 0 78 1 tcyN L-cystine transport system ATP-binding protein TcyN Escherichia coli (strain K12)
Q3KF57 1.88e-21 101 33 6 229 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas fluorescens (strain Pf0-1)
Q3KF57 3.76e-07 56 38 1 78 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas fluorescens (strain Pf0-1)
Q1LPJ9 1.91e-21 97 31 5 213 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q1LPJ9 1.66e-07 55 27 8 225 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q8XDV7 1.94e-21 97 28 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O157:H7
Q8XDV7 4.07e-11 67 22 7 232 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O157:H7
Q9HYL7 1.94e-21 97 30 7 252 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9HYL7 5.28e-05 48 22 8 244 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q0A8P9 2.05e-21 96 29 5 228 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q0A8P9 6.02e-11 65 27 8 225 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
P0A9V4 2.14e-21 96 26 2 238 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Shigella flexneri
P0A9V4 5.73e-13 72 23 4 220 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Shigella flexneri
P0A9V1 2.14e-21 96 26 2 238 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli (strain K12)
P0A9V1 5.73e-13 72 23 4 220 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli (strain K12)
P0A9V2 2.14e-21 96 26 2 238 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9V2 5.73e-13 72 23 4 220 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9V3 2.14e-21 96 26 2 238 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli O157:H7
P0A9V3 5.73e-13 72 23 4 220 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli O157:H7
Q65VG9 2.14e-21 98 27 6 306 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q65VG9 1.29e-12 72 28 8 231 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q31TP8 2.33e-21 97 28 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Shigella boydii serotype 4 (strain Sb227)
Q31TP8 2.91e-12 70 22 7 232 3 phnC Phosphonates import ATP-binding protein PhnC Shigella boydii serotype 4 (strain Sb227)
Q9I190 2.35e-21 101 29 5 228 1 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9I190 1.48e-08 60 27 10 217 1 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02MI4 2.35e-21 101 29 5 228 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas aeruginosa (strain UCBPP-PA14)
Q02MI4 1.48e-08 60 27 10 217 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas aeruginosa (strain UCBPP-PA14)
P0CZ31 2.42e-21 98 30 5 237 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ31 1.07e-16 85 29 6 236 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ30 2.42e-21 98 30 5 237 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0CZ30 1.07e-16 85 29 6 236 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q48V78 2.49e-21 98 30 5 237 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q48V78 1.47e-17 87 30 6 236 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q9A1E3 2.49e-21 98 30 5 237 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M1
Q9A1E3 1.47e-17 87 30 6 236 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M1
Q9PDN2 2.5e-21 98 27 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain 9a5c)
Q9PDN2 9.6e-13 73 26 5 205 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain 9a5c)
Q88WA5 2.52e-21 98 29 5 237 3 metN1 Methionine import ATP-binding protein MetN 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88WA5 2.64e-17 86 29 5 211 3 metN1 Methionine import ATP-binding protein MetN 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q81IZ6 2.7e-21 98 32 4 224 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81IZ6 7.72e-12 70 28 9 228 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q07PZ0 2.75e-21 97 31 7 250 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain BisA53)
Q07PZ0 3.59e-08 58 23 6 233 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain BisA53)
P21629 2.88e-21 96 30 6 228 3 braF High-affinity branched-chain amino acid transport ATP-binding protein BraF Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P21629 1.15e-14 77 27 7 224 3 braF High-affinity branched-chain amino acid transport ATP-binding protein BraF Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0C2H2 2.96e-21 100 30 4 222 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli
P0C2H2 4.92e-07 56 33 1 78 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli
P0C2H3 2.96e-21 100 30 4 222 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Escherichia coli O1:K1 / APEC
P0C2H3 4.92e-07 56 33 1 78 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Escherichia coli O1:K1 / APEC
Q13VD7 3.15e-21 98 31 4 229 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
Q13VD7 3.94e-14 77 26 5 214 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
Q87DT9 3.2e-21 98 27 2 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q87DT9 5.3e-12 70 25 5 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q88AS5 3.3e-21 97 26 2 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88AS5 1.57e-12 72 25 6 209 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q2IYS5 3.84e-21 96 30 7 244 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain HaA2)
Q2IYS5 1.44e-09 62 23 6 234 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain HaA2)
Q3BNZ3 3.91e-21 97 28 5 233 3 metN Methionine import ATP-binding protein MetN Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q3BNZ3 4.94e-12 70 26 7 209 3 metN Methionine import ATP-binding protein MetN Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A0PY57 4.04e-21 97 28 5 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium novyi (strain NT)
A0PY57 2.55e-18 89 29 5 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium novyi (strain NT)
Q0K9I2 4.2e-21 97 25 5 259 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q0K9I2 5.62e-14 76 25 6 208 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q67SV5 4.57e-21 97 28 6 244 3 metN Methionine import ATP-binding protein MetN Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q67SV5 2.35e-09 62 26 6 211 3 metN Methionine import ATP-binding protein MetN Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q0K1N8 4.63e-21 96 28 8 252 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q0K1N8 0.000258 46 22 8 234 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q73F11 4.68e-21 97 31 4 224 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q73F11 2.51e-11 68 27 7 214 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q62K82 4.68e-21 97 26 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
Q62K82 1.49e-13 75 28 7 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
Q63TY1 4.82e-21 97 26 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
Q63TY1 1.49e-13 75 28 7 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
Q9WYI7 4.84e-21 95 28 4 228 3 TM_0352 Uncharacterized ABC transporter ATP-binding protein TM_0352 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9WYI7 8.68e-11 65 29 9 213 3 TM_0352 Uncharacterized ABC transporter ATP-binding protein TM_0352 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q7MU65 4.91e-21 94 30 5 223 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q7MU65 1.76e-08 58 25 6 210 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q3JSQ0 5.02e-21 97 28 3 220 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain 1710b)
Q3JSQ0 1.5e-17 86 28 5 223 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain 1710b)
Q62K72 5.02e-21 97 28 3 220 3 nodI Nod factor export ATP-binding protein I Burkholderia mallei (strain ATCC 23344)
Q62K72 1.5e-17 86 28 5 223 3 nodI Nod factor export ATP-binding protein I Burkholderia mallei (strain ATCC 23344)
Q63TX3 5.07e-21 97 28 3 220 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain K96243)
Q63TX3 1.46e-17 86 28 5 223 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain K96243)
Q8PGE8 5.14e-21 97 28 5 233 3 metN Methionine import ATP-binding protein MetN Xanthomonas axonopodis pv. citri (strain 306)
Q8PGE8 4.85e-12 70 26 7 209 3 metN Methionine import ATP-binding protein MetN Xanthomonas axonopodis pv. citri (strain 306)
Q1BWI2 5.58e-21 96 28 3 228 3 nodI Nod factor export ATP-binding protein I Burkholderia orbicola (strain AU 1054)
Q1BWI2 1.65e-17 86 29 4 207 3 nodI Nod factor export ATP-binding protein I Burkholderia orbicola (strain AU 1054)
Q7N6F9 5.81e-21 100 33 4 206 3 macB Macrolide export ATP-binding/permease protein MacB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7N6F9 2.84e-09 63 25 12 247 3 macB Macrolide export ATP-binding/permease protein MacB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6D1C4 5.86e-21 97 29 4 232 3 metN3 Methionine import ATP-binding protein MetN 3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D1C4 8.74e-13 73 27 6 207 3 metN3 Methionine import ATP-binding protein MetN 3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9HT70 5.99e-21 97 28 5 233 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9HT70 4.71e-11 67 27 5 206 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DK6 5.99e-21 97 28 5 233 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q02DK6 4.71e-11 67 27 5 206 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q6NJ07 6.01e-21 97 30 4 223 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q6NJ07 6.53e-14 76 28 7 225 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q2KVK2 6.39e-21 97 29 5 226 3 metN Methionine import ATP-binding protein MetN Bordetella avium (strain 197N)
Q2KVK2 5.51e-08 58 26 9 237 3 metN Methionine import ATP-binding protein MetN Bordetella avium (strain 197N)
Q8DQY5 6.67e-21 99 25 23 525 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q8DQY5 1.03e-16 86 28 5 230 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
O34814 6.71e-21 94 28 3 217 1 ftsE Cell division ATP-binding protein FtsE Bacillus subtilis (strain 168)
O34814 1.42e-12 70 26 7 210 1 ftsE Cell division ATP-binding protein FtsE Bacillus subtilis (strain 168)
Q8NXH5 6.95e-21 97 29 6 254 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MW2)
Q8NXH5 7.19e-11 67 27 6 213 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MW2)
Q6GB18 6.95e-21 97 29 6 254 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MSSA476)
Q6GB18 7.19e-11 67 27 6 213 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MSSA476)
Q5HHK4 6.95e-21 97 29 6 254 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain COL)
Q5HHK4 7.19e-11 67 27 6 213 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain COL)
Q2FZZ2 6.95e-21 97 29 6 254 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FZZ2 7.19e-11 67 27 6 213 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FII2 6.95e-21 97 29 6 254 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain USA300)
Q2FII2 7.19e-11 67 27 6 213 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain USA300)
Q7N8M2 7.08e-21 97 29 4 232 3 metN Methionine import ATP-binding protein MetN Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7N8M2 9.75e-13 72 27 5 209 3 metN Methionine import ATP-binding protein MetN Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7A6M2 7.29e-21 97 29 6 254 1 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain N315)
Q7A6M2 1.64e-10 66 28 7 214 1 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain N315)
Q99VG8 7.29e-21 97 29 6 254 1 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q99VG8 1.64e-10 66 28 7 214 1 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YWP2 7.29e-21 97 29 6 254 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2YWP2 8.16e-11 67 28 7 213 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8P2K6 7.31e-21 97 30 5 237 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q8P2K6 8.46e-17 85 30 7 217 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5LUD0 7.4e-21 94 30 6 231 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q5LUD0 1.77e-07 55 36 2 82 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q4ZV10 7.67e-21 99 32 5 225 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas syringae pv. syringae (strain B728a)
Q4ZV10 3.43e-06 53 34 1 78 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas syringae pv. syringae (strain B728a)
Q667L9 7.86e-21 97 30 5 232 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q667L9 3.13e-12 71 27 5 220 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q5FKL2 8.08e-21 97 30 5 231 3 metN Methionine import ATP-binding protein MetN Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q5FKL2 4.22e-12 71 26 5 208 3 metN Methionine import ATP-binding protein MetN Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q8P4S7 8.11e-21 97 28 5 233 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8P4S7 2.16e-11 68 25 5 208 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UQD2 8.11e-21 97 28 5 233 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain 8004)
Q4UQD2 2.16e-11 68 25 5 208 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain 8004)
Q4W575 8.13e-21 97 32 5 226 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q4W575 1.33e-14 78 29 7 227 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00440
Feature type CDS
Gene rbsA
Product ribose ABC transporter ATP-binding protein RbsA
Location 118294 - 119802 (strand: -1)
Length 1509 (nucleotides) / 502 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_11
Orthogroup size 19
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1129 Carbohydrate transport and metabolism (G) G ABC-type sugar transport system, ATPase component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K10441 ribose transport system ATP-binding protein [EC:7.5.2.7] ABC transporters -

Protein Sequence

MEALLELKNIDKSFPGVKALSGATLRIYPGRVMALVGENGAGKSTLMKVLTGIYQKDAGEIIYQGERCSFNGPKSSQEAGIGIIHQELNLIPELTIAENIFLGREFTRAFGAIDWKKMYAEADKLLARLNLPYRSHRSVSELSIGDQQMVEIAKVLSFGSKVIIMDEPTDALTDTETRSLFSVITELRNQGCGIVYISHRLKEIFDICDDVTVLRDGQFIGEKPVSSLQEETLIEMMVGRKLEDQYPRIHIPAGKTKLNVSHLSGADIHDVSFSLYENEILGISGLMGAGRTELMKMIYGALPKTQGSVALEGKICQIKKPADALAQGIVYISEDRKRDGLVLGMSVKENMSLTALPYFSRTMGILNHKEEQLTVSDFIKLFNIKTPSINQIIGFLSGGNQQKVAIARGLMTRPKVLILDEPTRGVDVGAKKEIYQLINKFKQEGLSIILISSEMPEVMGMSDRILVMHEGRISGEFSANNVTQEMLMAAAVGKQYGATVGV

Flanking regions ( +/- flanking 50bp)

TCCTTATGCCAATATCGTGCTGTTTTCTGGTGTGACTTTCTGAGGCCAATATGGAAGCATTACTTGAATTAAAAAATATTGATAAATCATTTCCAGGCGTAAAAGCATTATCTGGTGCGACGTTACGAATTTATCCTGGCCGAGTGATGGCACTTGTTGGTGAAAATGGCGCAGGTAAATCCACACTAATGAAAGTGCTAACAGGTATCTACCAAAAAGACGCAGGTGAAATTATTTATCAAGGGGAACGTTGCTCTTTTAATGGTCCTAAGTCTTCTCAAGAAGCCGGAATAGGTATTATCCATCAAGAACTCAATCTTATCCCTGAATTAACCATTGCAGAAAATATCTTTTTAGGTCGCGAGTTTACCCGTGCATTTGGTGCCATTGATTGGAAAAAAATGTATGCAGAAGCGGATAAATTACTTGCTCGCTTAAACCTTCCTTATCGCAGTCATCGCTCAGTTTCTGAATTATCCATTGGTGATCAGCAAATGGTTGAAATTGCCAAAGTACTCAGTTTTGGCTCTAAAGTGATTATTATGGATGAACCGACAGATGCATTGACAGACACCGAAACTCGCTCTCTGTTTAGTGTGATAACTGAATTAAGAAATCAAGGTTGTGGCATTGTCTATATCTCACATCGATTAAAAGAAATTTTTGATATTTGTGATGATGTAACTGTGTTGCGCGATGGTCAATTTATTGGCGAAAAGCCCGTTTCTTCATTACAAGAAGAGACACTTATTGAAATGATGGTAGGCCGTAAATTAGAAGATCAATACCCTCGCATCCATATTCCTGCAGGAAAAACTAAACTTAATGTCTCTCACTTAAGTGGTGCAGATATACATGATGTCAGCTTCTCCCTATATGAAAATGAAATTTTAGGTATTTCAGGGTTAATGGGCGCAGGCCGTACTGAATTAATGAAAATGATTTACGGTGCATTGCCAAAAACACAAGGTAGCGTGGCGTTAGAAGGTAAAATTTGTCAGATCAAAAAGCCTGCAGATGCACTTGCCCAAGGTATTGTTTATATCTCTGAAGACAGAAAACGCGATGGTTTAGTGCTAGGTATGTCAGTAAAAGAGAATATGTCACTGACGGCGCTACCTTATTTTAGTCGCACTATGGGGATCTTAAATCATAAAGAAGAGCAATTAACTGTCAGTGACTTTATTAAATTGTTCAACATAAAAACCCCGTCCATCAATCAGATCATTGGTTTTTTATCAGGCGGTAATCAGCAAAAAGTCGCTATTGCTCGCGGACTAATGACTCGTCCTAAAGTGCTTATTCTTGATGAGCCTACCCGCGGTGTCGATGTGGGGGCGAAAAAAGAGATTTACCAATTAATTAATAAGTTTAAACAAGAGGGATTAAGCATCATTTTGATCTCTTCAGAAATGCCAGAGGTAATGGGAATGAGTGACCGCATTTTAGTTATGCATGAAGGTCGTATCAGCGGTGAGTTTTCTGCCAATAATGTCACACAAGAGATGCTAATGGCGGCGGCTGTTGGTAAACAATATGGTGCTACAGTAGGAGTTTGAGATGAGTACAAAATCAATACCAGCGTCAAAACGATGGTTCTCTAAGGCTT