Homologs in group_11

Help

18 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04505 FBDBKF_04505 44.5 Morganella morganii S1 mglA galactose/methyl galactoside ABC transporter ATP-binding protein MglA
FBDBKF_04700 FBDBKF_04700 44.9 Morganella morganii S1 xylG ABC-type sugar transport system, ATPase component
FBDBKF_15410 FBDBKF_15410 94.6 Morganella morganii S1 rbsA ribose ABC transporter ATP-binding protein RbsA
EHELCC_05795 EHELCC_05795 44.5 Morganella morganii S2 mglA galactose/methyl galactoside ABC transporter ATP-binding protein MglA
EHELCC_05990 EHELCC_05990 44.9 Morganella morganii S2 xylG ABC-type sugar transport system, ATPase component
EHELCC_15770 EHELCC_15770 94.6 Morganella morganii S2 rbsA ribose ABC transporter ATP-binding protein RbsA
NLDBIP_06115 NLDBIP_06115 44.5 Morganella morganii S4 mglA galactose/methyl galactoside ABC transporter ATP-binding protein MglA
NLDBIP_06310 NLDBIP_06310 44.9 Morganella morganii S4 xylG ABC-type sugar transport system, ATPase component
NLDBIP_16600 NLDBIP_16600 94.6 Morganella morganii S4 rbsA ribose ABC transporter ATP-binding protein RbsA
LHKJJB_02995 LHKJJB_02995 44.5 Morganella morganii S3 mglA galactose/methyl galactoside ABC transporter ATP-binding protein MglA
LHKJJB_03190 LHKJJB_03190 44.9 Morganella morganii S3 xylG ABC-type sugar transport system, ATPase component
LHKJJB_16205 LHKJJB_16205 94.6 Morganella morganii S3 rbsA ribose ABC transporter ATP-binding protein RbsA
HKOGLL_06470 HKOGLL_06470 44.5 Morganella morganii S5 mglA galactose/methyl galactoside ABC transporter ATP-binding protein MglA
HKOGLL_06665 HKOGLL_06665 44.9 Morganella morganii S5 xylG ABC-type sugar transport system, ATPase component
HKOGLL_15975 HKOGLL_15975 94.6 Morganella morganii S5 rbsA ribose ABC transporter ATP-binding protein RbsA
F4V73_RS09120 F4V73_RS09120 41.4 Morganella psychrotolerans - sugar ABC transporter ATP-binding protein
F4V73_RS09175 F4V73_RS09175 45.7 Morganella psychrotolerans - sugar ABC transporter ATP-binding protein
PMI_RS00440 PMI_RS00440 84.6 Proteus mirabilis HI4320 rbsA ribose ABC transporter ATP-binding protein RbsA

Distribution of the homologs in the orthogroup group_11

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_11

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q6DB87 0.0 836 81 0 501 3 rbsA Ribose import ATP-binding protein RbsA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7NA79 0.0 823 81 0 501 3 rbsA Ribose import ATP-binding protein RbsA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q1R4I3 0.0 802 79 0 501 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli (strain UTI89 / UPEC)
P04983 0.0 800 79 0 501 1 rbsA Ribose import ATP-binding protein RbsA Escherichia coli (strain K12)
Q0TAW0 0.0 800 79 0 501 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8FBS3 0.0 799 79 0 501 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8XAW7 0.0 798 78 0 501 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Escherichia coli O157:H7
Q57HW1 0.0 797 78 0 501 3 rbsA Ribose import ATP-binding protein RbsA Salmonella choleraesuis (strain SC-B67)
Q8ZKV9 0.0 796 78 0 501 3 rbsA Ribose import ATP-binding protein RbsA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PJX5 0.0 794 78 0 501 3 rbsA Ribose import ATP-binding protein RbsA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q3YVK8 0.0 792 78 0 501 3 rbsA Ribose import ATP-binding protein RbsA Shigella sonnei (strain Ss046)
Q8Z2R4 0.0 792 78 0 501 3 rbsA Ribose import ATP-binding protein RbsA Salmonella typhi
Q9CP98 0.0 735 73 1 493 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Pasteurella multocida (strain Pm70)
Q9CP98 5.95e-17 87 26 3 226 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Pasteurella multocida (strain Pm70)
Q7MEV1 0.0 732 73 1 494 3 rbsA Ribose import ATP-binding protein RbsA Vibrio vulnificus (strain YJ016)
Q7MEV1 3.54e-15 81 25 3 221 3 rbsA Ribose import ATP-binding protein RbsA Vibrio vulnificus (strain YJ016)
Q8D7T7 0.0 732 73 1 494 3 rbsA Ribose import ATP-binding protein RbsA Vibrio vulnificus (strain CMCP6)
Q8D7T7 5.52e-15 80 25 3 221 3 rbsA Ribose import ATP-binding protein RbsA Vibrio vulnificus (strain CMCP6)
Q87H79 0.0 725 73 1 494 3 rbsA Ribose import ATP-binding protein RbsA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87H79 2.01e-14 79 24 4 222 3 rbsA Ribose import ATP-binding protein RbsA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q4QN44 0.0 723 71 1 494 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain 86-028NP)
Q4QN44 6.11e-19 93 25 3 228 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain 86-028NP)
P44735 0.0 720 71 1 494 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44735 4.54e-19 93 25 3 228 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5E4V6 0.0 715 72 1 493 3 rbsA Ribose import ATP-binding protein RbsA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q5E4V6 8.97e-19 92 26 4 236 3 rbsA Ribose import ATP-binding protein RbsA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q5E4V6 1.94e-14 79 24 5 249 3 rbsA Ribose import ATP-binding protein RbsA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q9KN37 0.0 711 71 1 494 3 rbsA Ribose import ATP-binding protein RbsA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q6LH11 0.0 710 71 1 493 3 rbsA Ribose import ATP-binding protein RbsA Photobacterium profundum (strain SS9)
Q6LH11 5.84e-18 90 25 3 228 3 rbsA Ribose import ATP-binding protein RbsA Photobacterium profundum (strain SS9)
Q6LH11 4.65e-17 87 25 5 240 3 rbsA Ribose import ATP-binding protein RbsA Photobacterium profundum (strain SS9)
Q8RD43 0.0 521 51 1 494 3 rbsA Ribose import ATP-binding protein RbsA Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8RD43 3.81e-21 99 29 3 228 3 rbsA Ribose import ATP-binding protein RbsA Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q0SSJ0 8.23e-180 516 52 2 493 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain SM101 / Type A)
Q0SSJ0 3.3e-17 87 25 5 231 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain SM101 / Type A)
Q0TPX5 9.9e-180 516 52 2 493 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0TPX5 3.39e-17 87 25 5 231 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8XJX3 1.57e-179 516 52 2 493 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain 13 / Type A)
Q8XJX3 5.35e-17 87 25 5 231 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain 13 / Type A)
Q891M1 5.29e-176 507 50 2 494 3 rbsA Ribose import ATP-binding protein RbsA Clostridium tetani (strain Massachusetts / E88)
Q891M1 2.77e-17 88 26 4 232 3 rbsA Ribose import ATP-binding protein RbsA Clostridium tetani (strain Massachusetts / E88)
Q4KDI2 1.44e-163 476 48 3 494 3 PFL_2594 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4KDI2 1.32e-18 92 27 3 226 3 PFL_2594 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q8RBQ1 1.82e-163 475 49 2 491 3 TTE0763 Putative ribose/galactose/methyl galactoside import ATP-binding protein Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q5KUX3 3.51e-163 474 48 4 493 3 rbsA Ribose import ATP-binding protein RbsA Geobacillus kaustophilus (strain HTA426)
Q5KUX3 3e-22 103 28 4 234 3 rbsA Ribose import ATP-binding protein RbsA Geobacillus kaustophilus (strain HTA426)
Q48GY7 9.22e-162 471 48 2 493 3 PSPPH_3184 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q48GY7 2.16e-15 82 24 3 219 3 PSPPH_3184 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q87ZE0 1.36e-161 471 47 2 493 3 PSPTO_3489 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q87ZE0 4.13e-16 84 25 3 219 3 PSPTO_3489 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZRC6 2.51e-161 471 48 2 493 3 Psyr_3264 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas syringae pv. syringae (strain B728a)
Q4ZRC6 7.13e-17 87 26 3 219 3 Psyr_3264 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas syringae pv. syringae (strain B728a)
Q6HNE7 4.32e-161 469 48 3 491 3 rbsA Ribose import ATP-binding protein RbsA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HNE7 1.34e-22 104 29 5 243 3 rbsA Ribose import ATP-binding protein RbsA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81V36 4.32e-161 469 48 3 491 3 rbsA Ribose import ATP-binding protein RbsA Bacillus anthracis
Q81V36 1.34e-22 104 29 5 243 3 rbsA Ribose import ATP-binding protein RbsA Bacillus anthracis
Q63FX9 3.49e-160 466 48 3 491 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ZK / E33L)
Q63FX9 1.15e-22 104 29 5 243 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ZK / E33L)
Q81HW8 2.06e-159 464 48 3 491 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81HW8 1.63e-20 97 29 5 243 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q5KYS1 2.84e-159 464 49 5 500 3 xylG Xylose import ATP-binding protein XylG Geobacillus kaustophilus (strain HTA426)
Q5KYS1 7.61e-15 80 25 4 232 3 xylG Xylose import ATP-binding protein XylG Geobacillus kaustophilus (strain HTA426)
Q5KYS1 8.45e-14 77 24 5 237 3 xylG Xylose import ATP-binding protein XylG Geobacillus kaustophilus (strain HTA426)
Q73DH7 2.11e-158 462 47 3 491 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q73DH7 3.34e-23 105 30 5 243 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8UBN2 4e-158 461 47 4 496 3 Atu2819 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9X051 2.56e-157 460 47 3 503 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9X051 5.68e-20 96 27 4 230 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q2SMT0 3.01e-157 460 47 2 485 3 HCH_01167 Putative ribose/galactose/methyl galactoside import ATP-binding protein Hahella chejuensis (strain KCTC 2396)
Q2SMT0 1.72e-14 79 25 3 226 3 HCH_01167 Putative ribose/galactose/methyl galactoside import ATP-binding protein Hahella chejuensis (strain KCTC 2396)
Q6VMN4 2.09e-156 457 47 6 505 3 xylG Xylose import ATP-binding protein XylG Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q6VMN4 8.3e-19 92 26 4 237 3 xylG Xylose import ATP-binding protein XylG Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q6VMN4 8.3e-16 83 27 5 237 3 xylG Xylose import ATP-binding protein XylG Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q1BWN5 1.98e-155 455 46 6 503 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia orbicola (strain AU 1054)
A0K718 1.98e-155 455 46 6 503 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia cenocepacia (strain HI2424)
P36947 2.45e-155 454 47 2 490 3 rbsA Ribose import ATP-binding protein RbsA Bacillus subtilis (strain 168)
Q65E55 3.67e-155 454 47 2 490 3 rbsA Ribose import ATP-binding protein RbsA Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q0BG60 5.69e-155 454 46 2 483 3 Bamb_1305 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q0BG60 4.67e-16 84 26 4 226 3 Bamb_1305 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q3JHZ1 8.96e-155 453 45 6 504 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia pseudomallei (strain 1710b)
Q8ENB3 1.86e-154 452 46 4 497 3 rbsA Ribose import ATP-binding protein RbsA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q13FD9 3.32e-154 451 45 3 498 3 Bxeno_C1272 Putative ribose/galactose/methyl galactoside import ATP-binding protein Paraburkholderia xenovorans (strain LB400)
Q63P06 3.45e-154 452 45 6 504 3 rbsA Ribose import ATP-binding protein RbsA Burkholderia pseudomallei (strain K96243)
Q1BX03 7.08e-154 451 46 2 483 3 Bcen_0943 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia orbicola (strain AU 1054)
Q1BX03 1.46e-16 85 26 4 226 3 Bcen_0943 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia orbicola (strain AU 1054)
A0K6Q0 7.08e-154 451 46 2 483 3 Bcen2424_1425 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia cenocepacia (strain HI2424)
A0K6Q0 1.46e-16 85 26 4 226 3 Bcen2424_1425 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia cenocepacia (strain HI2424)
Q39HA1 7.24e-154 451 46 2 483 3 Bcep18194_A4569 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q39HA1 3.1e-16 84 25 4 226 3 Bcep18194_A4569 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BFU0 1.03e-153 451 45 6 503 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q39GY8 1.07e-153 451 45 6 506 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q66C83 2.77e-153 449 45 4 492 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q66C83 3.82e-14 78 23 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CGT1 2.77e-153 449 45 4 492 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CGT1 3.82e-14 78 23 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CHQ3 2.77e-153 449 45 4 492 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pestis
Q7CHQ3 3.82e-14 78 23 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pestis
Q1C9V1 2.77e-153 449 45 4 492 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C9V1 3.82e-14 78 23 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pestis bv. Antiqua (strain Antiqua)
Q8E7N9 2.87e-153 449 47 1 489 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype III (strain NEM316)
Q8E7N9 5.97e-20 96 29 4 225 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype III (strain NEM316)
Q8E7N9 3.11e-19 94 28 3 225 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype III (strain NEM316)
Q2T8T6 4.43e-153 449 45 6 504 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q3K3R2 5.39e-153 448 47 1 489 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q3K3R2 1.13e-19 95 29 4 225 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q3K3R2 2.21e-19 94 28 3 225 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8UAK2 5.94e-153 449 45 1 491 3 Atu3371 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8UAK2 1.6e-19 95 27 3 226 3 Atu3371 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q1AXG5 1.66e-152 447 46 6 497 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q2K353 2.21e-152 447 46 1 491 3 RHE_CH03989 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2K353 1.42e-20 98 28 3 226 3 RHE_CH03989 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q82CM5 2.29e-152 447 47 5 497 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8E281 3.9e-152 446 46 1 489 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E281 1.25e-19 95 29 4 225 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E281 7.1e-19 92 27 3 225 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q2NUD6 8.31e-152 446 45 4 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Sodalis glossinidius (strain morsitans)
Q2NUD6 2.87e-15 81 24 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Sodalis glossinidius (strain morsitans)
Q9RDI1 1.05e-151 446 47 4 497 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q825P1 1.16e-151 445 44 2 487 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q2RGX2 1.36e-151 445 46 5 501 3 xylG Xylose import ATP-binding protein XylG Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q2RGX2 1.5e-16 85 29 7 234 3 xylG Xylose import ATP-binding protein XylG Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q2RGX2 1.02e-13 77 25 5 233 3 xylG Xylose import ATP-binding protein XylG Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q8CK44 1.51e-151 445 44 2 487 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8X5D9 1.74e-151 445 45 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O157:H7
Q8X5D9 4.34e-16 84 26 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O157:H7
Q1MAA2 1.84e-151 445 45 1 491 3 RL4654 Putative ribose/galactose/methyl galactoside import ATP-binding protein Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1MAA2 6.41e-22 102 29 3 226 3 RL4654 Putative ribose/galactose/methyl galactoside import ATP-binding protein Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q6LK34 2.38e-151 444 46 3 491 3 mglA1 Galactose/methyl galactoside import ATP-binding protein MglA 1 Photobacterium profundum (strain SS9)
Q6LK34 2.69e-16 85 25 4 232 3 mglA1 Galactose/methyl galactoside import ATP-binding protein MglA 1 Photobacterium profundum (strain SS9)
Q0B775 3.9e-151 444 45 4 497 3 Bamb_4447 Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q2KAW9 4.26e-151 444 47 3 496 3 RHE_CH01212 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2KAW9 1.65e-11 70 27 5 215 3 RHE_CH01212 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q3Z057 5.33e-151 443 45 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella sonnei (strain Ss046)
Q3Z057 4.58e-16 84 26 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella sonnei (strain Ss046)
P0AAG9 5.33e-151 443 45 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella flexneri
P0AAG9 4.58e-16 84 26 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella flexneri
P0AAG8 5.33e-151 443 45 2 493 1 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli (strain K12)
P0AAG8 4.58e-16 84 26 3 225 1 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli (strain K12)
Q8FFU7 5.33e-151 443 45 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FFU7 4.58e-16 84 26 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFU2 5.33e-151 443 45 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TFU2 4.58e-16 84 26 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8Y003 7.17e-151 444 45 1 489 3 RSc1242 Putative ribose/galactose/methyl galactoside import ATP-binding protein Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8Y003 1.93e-15 82 26 4 227 3 RSc1242 Putative ribose/galactose/methyl galactoside import ATP-binding protein Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q1R9S4 8.98e-151 443 45 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli (strain UTI89 / UPEC)
Q1R9S4 9.33e-17 86 26 3 226 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli (strain UTI89 / UPEC)
Q5KYQ7 1.18e-150 442 45 3 493 3 GK1894 Putative ribose/galactose/methyl galactoside import ATP-binding protein Geobacillus kaustophilus (strain HTA426)
Q5KYQ7 7.12e-19 92 29 5 238 3 GK1894 Putative ribose/galactose/methyl galactoside import ATP-binding protein Geobacillus kaustophilus (strain HTA426)
Q5KYQ7 8.94e-16 83 24 5 228 3 GK1894 Putative ribose/galactose/methyl galactoside import ATP-binding protein Geobacillus kaustophilus (strain HTA426)
Q9K6J9 1.26e-150 442 45 4 494 3 rbsA Ribose import ATP-binding protein RbsA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9K6J9 6.39e-22 102 28 4 238 3 rbsA Ribose import ATP-binding protein RbsA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q0T2X5 1.26e-150 442 44 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella flexneri serotype 5b (strain 8401)
Q0T2X5 5.52e-16 84 26 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella flexneri serotype 5b (strain 8401)
Q5WC31 1.7e-150 442 45 4 494 3 rbsA Ribose import ATP-binding protein RbsA Shouchella clausii (strain KSM-K16)
Q5WC31 4.04e-23 105 30 4 240 3 rbsA Ribose import ATP-binding protein RbsA Shouchella clausii (strain KSM-K16)
Q92S10 3.42e-150 441 44 3 497 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rhizobium meliloti (strain 1021)
Q92S10 2.47e-16 85 29 4 233 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rhizobium meliloti (strain 1021)
Q92TS8 5.23e-150 441 45 1 491 3 RB1420 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Rhizobium meliloti (strain 1021)
Q92TS8 4.66e-18 90 27 4 227 3 RB1420 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Rhizobium meliloti (strain 1021)
Q31YV7 1.36e-149 440 44 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella boydii serotype 4 (strain Sb227)
Q31YV7 2.78e-16 85 26 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella boydii serotype 4 (strain Sb227)
Q6LUY1 2.27e-149 439 45 5 509 3 xylG Xylose import ATP-binding protein XylG Photobacterium profundum (strain SS9)
Q8FCE2 3.43e-149 439 44 4 507 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FCE2 2.64e-13 75 27 5 234 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBN5 3.43e-149 439 44 4 507 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TBN5 2.64e-13 75 27 5 234 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1R528 6.03e-149 438 44 4 507 3 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain UTI89 / UPEC)
Q1R528 2.96e-13 75 27 5 234 3 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain UTI89 / UPEC)
Q31V51 9.93e-149 438 44 4 507 3 xylG Xylose import ATP-binding protein XylG Shigella boydii serotype 4 (strain Sb227)
Q31V51 2.99e-13 75 27 5 234 3 xylG Xylose import ATP-binding protein XylG Shigella boydii serotype 4 (strain Sb227)
Q8XDM1 9.93e-149 438 44 4 507 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O157:H7
Q8XDM1 2.99e-13 75 27 5 234 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O157:H7
Q399X3 1.57e-148 437 45 4 498 3 Bcep18194_B0624 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q8U9B0 1.74e-148 437 45 3 492 3 Atu3818 Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9KAG5 1.84e-148 437 45 3 493 3 BH2322 Putative ribose/galactose/methyl galactoside import ATP-binding protein Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KAG5 2.38e-16 85 26 3 225 3 BH2322 Putative ribose/galactose/methyl galactoside import ATP-binding protein Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P37388 1.95e-148 437 44 4 507 1 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain K12)
P37388 1.09e-12 73 26 5 234 1 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain K12)
Q0SY86 3.43e-148 436 44 4 507 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri serotype 5b (strain 8401)
Q0SY86 3.93e-13 75 27 5 234 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri serotype 5b (strain 8401)
Q1BQ82 7.09e-148 436 44 3 497 3 Bcen_3328 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia orbicola (strain AU 1054)
A0B297 7.09e-148 436 44 3 497 3 Bcen2424_5039 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia cenocepacia (strain HI2424)
Q1BGC0 1.62e-147 435 46 3 496 3 Bcen_6474 Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 Burkholderia orbicola (strain AU 1054)
A0KE25 1.62e-147 435 46 3 496 3 Bcen2424_6709 Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 Burkholderia cenocepacia (strain HI2424)
P23924 1.97e-147 434 43 2 493 1 mglA Galactose/methyl galactoside import ATP-binding protein MglA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P23924 3.09e-16 84 25 3 225 1 mglA Galactose/methyl galactoside import ATP-binding protein MglA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q83J33 2.5e-147 434 44 4 507 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri
Q83J33 4.12e-12 72 26 5 234 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri
Q7NTN6 9.71e-147 432 46 4 489 3 rbsA Ribose import ATP-binding protein RbsA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7NTN6 1.2e-16 86 29 2 230 3 rbsA Ribose import ATP-binding protein RbsA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q1M5X4 1.32e-146 432 43 2 492 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2K0S7 1.47e-146 432 44 2 492 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q6LG59 2.39e-146 431 44 4 494 3 mglA2 Galactose/methyl galactoside import ATP-binding protein MglA 2 Photobacterium profundum (strain SS9)
Q6LG59 6.58e-13 74 23 4 226 3 mglA2 Galactose/methyl galactoside import ATP-binding protein MglA 2 Photobacterium profundum (strain SS9)
Q21TR5 2.39e-146 431 46 4 498 3 Rfer_3129 Putative ribose/galactose/methyl galactoside import ATP-binding protein Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q664G2 4.21e-146 431 44 4 493 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q664G2 8.24e-23 105 30 3 224 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q3MB44 4.39e-146 431 45 6 497 3 rbsA Ribose import ATP-binding protein RbsA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q3MB44 5.38e-21 99 27 3 227 3 rbsA Ribose import ATP-binding protein RbsA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q1CDJ0 4.49e-146 431 44 4 493 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CDJ0 8.09e-23 105 30 3 224 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CG00 4.49e-146 431 44 4 493 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis
Q7CG00 8.09e-23 105 30 3 224 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis
Q1C1B8 4.49e-146 431 44 4 493 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C1B8 8.09e-23 105 30 3 224 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Antiqua)
Q6DB03 5.64e-146 431 44 5 509 3 xylG Xylose import ATP-binding protein XylG Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7UU57 1.33e-145 430 45 5 500 3 rbsA Ribose import ATP-binding protein RbsA Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q8X5Q4 1.35e-145 430 44 4 493 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Escherichia coli O157:H7
Q8X5Q4 5.38e-24 108 31 3 224 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Escherichia coli O157:H7
Q02XM9 2.97e-145 428 45 1 489 3 rbsA Ribose import ATP-binding protein RbsA Lactococcus lactis subsp. cremoris (strain SK11)
Q02XM9 1.12e-19 95 28 4 225 3 rbsA Ribose import ATP-binding protein RbsA Lactococcus lactis subsp. cremoris (strain SK11)
Q02XM9 1.3e-15 82 26 3 224 3 rbsA Ribose import ATP-binding protein RbsA Lactococcus lactis subsp. cremoris (strain SK11)
Q28P50 3.65e-145 429 43 2 493 3 rbsA Ribose import ATP-binding protein RbsA Jannaschia sp. (strain CCS1)
Q28P50 1.67e-15 82 28 4 226 3 rbsA Ribose import ATP-binding protein RbsA Jannaschia sp. (strain CCS1)
Q8REE1 7.4e-145 427 44 2 488 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8REE1 2.51e-18 91 26 4 232 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8REE1 1.55e-10 67 19 3 224 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q9CF44 7.64e-145 427 45 1 491 3 rbsA Ribose import ATP-binding protein RbsA Lactococcus lactis subsp. lactis (strain IL1403)
Q9KSD1 1.8e-144 427 43 4 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9KSD1 3.91e-12 72 23 4 226 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q13RB6 2.28e-144 427 43 5 503 3 xylG Xylose import ATP-binding protein XylG Paraburkholderia xenovorans (strain LB400)
Q13RB6 3.4e-16 84 26 5 243 3 xylG Xylose import ATP-binding protein XylG Paraburkholderia xenovorans (strain LB400)
Q1AVD3 6.76e-144 426 44 3 493 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q1AVD3 7.52e-15 80 26 4 229 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q1ARR5 2.12e-143 424 43 3 494 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q1ARR5 7.16e-22 102 29 4 244 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q1ARR5 7.74e-15 80 23 3 230 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q663Y5 2.31e-143 424 43 5 503 3 xylG Xylose import ATP-binding protein XylG Yersinia pseudotuberculosis serotype I (strain IP32953)
Q663Y5 1.1e-16 86 28 6 237 3 xylG Xylose import ATP-binding protein XylG Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CDC0 2.31e-143 424 43 5 503 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CDC0 1.1e-16 86 28 6 237 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CFR2 2.31e-143 424 43 5 503 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis
Q7CFR2 1.1e-16 86 28 6 237 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis
Q1C0D5 2.31e-143 424 43 5 503 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C0D5 1.1e-16 86 28 6 237 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Antiqua)
Q03CA4 2.66e-143 424 45 2 490 3 rbsA Ribose import ATP-binding protein RbsA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q03CA4 1.33e-24 110 31 3 225 3 rbsA Ribose import ATP-binding protein RbsA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q65UW1 2.81e-143 424 43 4 492 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q65UW1 3.32e-14 78 24 4 226 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8XKQ2 3.09e-143 424 43 2 487 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain 13 / Type A)
Q8XKQ2 2.14e-17 88 24 3 226 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain 13 / Type A)
Q8XKQ2 1.84e-12 73 20 3 223 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain 13 / Type A)
Q9CM08 4.11e-143 423 43 4 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Pasteurella multocida (strain Pm70)
Q9CM08 5.14e-16 84 23 3 226 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Pasteurella multocida (strain Pm70)
Q0BGD7 4.37e-143 424 44 5 498 3 Bamb_1228 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q576H3 5.16e-143 423 46 6 505 3 xylG Xylose import ATP-binding protein XylG Brucella abortus biovar 1 (strain 9-941)
Q576H3 3.44e-16 84 26 4 244 3 xylG Xylose import ATP-binding protein XylG Brucella abortus biovar 1 (strain 9-941)
Q2YJE7 5.16e-143 423 46 6 505 3 xylG Xylose import ATP-binding protein XylG Brucella abortus (strain 2308)
Q2YJE7 3.44e-16 84 26 4 244 3 xylG Xylose import ATP-binding protein XylG Brucella abortus (strain 2308)
Q7MG07 7.8e-143 422 43 4 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio vulnificus (strain YJ016)
Q7MG07 4.8e-14 78 25 4 226 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio vulnificus (strain YJ016)
Q0ST95 1.68e-142 422 44 2 487 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain SM101 / Type A)
Q0ST95 1.31e-17 89 24 3 226 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain SM101 / Type A)
Q0ST95 2.93e-12 72 20 4 241 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain SM101 / Type A)
Q8YDN0 2.28e-142 422 46 6 505 3 xylG Xylose import ATP-binding protein XylG Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8YDN0 5.71e-16 84 26 4 244 3 xylG Xylose import ATP-binding protein XylG Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q0TQU8 2.46e-142 422 43 2 487 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0TQU8 2.28e-17 88 24 3 226 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0TQU8 1.82e-12 73 20 4 241 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8D4H4 2.96e-142 421 42 4 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio vulnificus (strain CMCP6)
Q8D4H4 5.07e-14 77 25 4 226 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio vulnificus (strain CMCP6)
Q1BG93 3.08e-142 422 44 5 503 3 xylG Xylose import ATP-binding protein XylG Burkholderia orbicola (strain AU 1054)
Q1BG93 1.77e-15 82 26 5 243 3 xylG Xylose import ATP-binding protein XylG Burkholderia orbicola (strain AU 1054)
A0KE53 3.08e-142 422 44 5 503 3 xylG Xylose import ATP-binding protein XylG Burkholderia cenocepacia (strain HI2424)
A0KE53 1.77e-15 82 26 5 243 3 xylG Xylose import ATP-binding protein XylG Burkholderia cenocepacia (strain HI2424)
Q2SJ99 3.76e-142 421 44 2 496 3 rbsA Ribose import ATP-binding protein RbsA Hahella chejuensis (strain KCTC 2396)
Q2SJ99 2.93e-17 87 26 3 228 3 rbsA Ribose import ATP-binding protein RbsA Hahella chejuensis (strain KCTC 2396)
Q9K7C3 4.21e-141 419 46 6 499 3 araG L-arabinose transport ATP-binding protein AraG Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9K7C3 4.58e-12 72 26 5 234 3 araG L-arabinose transport ATP-binding protein AraG Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8FUR8 5.85e-141 418 46 6 505 3 xylG Xylose import ATP-binding protein XylG Brucella suis biovar 1 (strain 1330)
Q8FUR8 9.61e-15 80 26 4 244 3 xylG Xylose import ATP-binding protein XylG Brucella suis biovar 1 (strain 1330)
P44884 7.94e-141 417 43 4 492 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44884 5.91e-15 80 23 4 238 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QM77 7.94e-141 417 43 4 492 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Haemophilus influenzae (strain 86-028NP)
Q4QM77 5.91e-15 80 23 4 238 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Haemophilus influenzae (strain 86-028NP)
Q0S9A4 8.48e-141 417 43 3 500 3 rbsA Ribose import ATP-binding protein RbsA Rhodococcus jostii (strain RHA1)
Q1J3P2 1.56e-140 416 43 3 497 3 rbsA Ribose import ATP-binding protein RbsA Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q9CL63 2.12e-140 417 43 3 494 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Pasteurella multocida (strain Pm70)
Q8XPK6 2.15e-140 417 43 5 501 3 xylG Xylose import ATP-binding protein XylG Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8XPK6 1.05e-14 80 26 4 240 3 xylG Xylose import ATP-binding protein XylG Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8UA86 2.45e-140 416 43 2 493 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q0B1U4 4.53e-140 416 43 5 503 3 xylG Xylose import ATP-binding protein XylG Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q0B1U4 1.23e-15 83 27 5 243 3 xylG Xylose import ATP-binding protein XylG Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q329G7 3.59e-139 413 43 4 493 3 rbsA Ribose import ATP-binding protein RbsA Shigella dysenteriae serotype 1 (strain Sd197)
Q329G7 6.43e-23 105 31 3 224 3 rbsA Ribose import ATP-binding protein RbsA Shigella dysenteriae serotype 1 (strain Sd197)
Q896Y2 4.4e-139 413 44 4 495 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium tetani (strain Massachusetts / E88)
Q896Y2 2.62e-17 88 26 4 236 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium tetani (strain Massachusetts / E88)
Q164K3 4.43e-139 413 42 2 492 3 rbsA Ribose import ATP-binding protein RbsA Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q164K3 5.48e-14 77 25 6 256 3 rbsA Ribose import ATP-binding protein RbsA Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q65WJ1 4.8e-139 413 44 3 499 3 araG Arabinose import ATP-binding protein AraG Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q2SW38 9.64e-139 412 43 5 503 3 xylG Xylose import ATP-binding protein XylG Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2SW38 4.73e-16 84 27 5 243 3 xylG Xylose import ATP-binding protein XylG Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q1M360 1.27e-138 412 42 3 495 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1M360 1.02e-20 98 30 8 249 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q92W60 6.97e-138 410 42 4 499 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium meliloti (strain 1021)
Q92W60 1.06e-18 92 28 7 245 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium meliloti (strain 1021)
Q1BJW2 9.02e-138 410 45 3 494 3 araG2 Arabinose import ATP-binding protein AraG 2 Burkholderia orbicola (strain AU 1054)
A0B3Z7 9.02e-138 410 45 3 494 3 araG2 Arabinose import ATP-binding protein AraG 2 Burkholderia cenocepacia (strain HI2424)
Q8NR12 9.89e-138 410 43 4 493 3 rbsA Ribose import ATP-binding protein RbsA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q13LX0 1.05e-137 410 42 2 496 3 rbsA Ribose import ATP-binding protein RbsA Paraburkholderia xenovorans (strain LB400)
Q39BJ8 1.36e-136 407 44 3 494 3 araG2 Arabinose import ATP-binding protein AraG 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q2K204 1.87e-136 406 43 3 496 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q1JUP7 1.87e-136 407 44 3 494 3 araG Arabinose import ATP-binding protein AraG Azospirillum brasilense
Q0B5V4 8.63e-136 405 45 3 493 3 araG2 Arabinose import ATP-binding protein AraG 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q87FK7 2.66e-135 403 42 4 498 3 araG Arabinose import ATP-binding protein AraG Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1MBG4 7.23e-135 402 42 5 502 3 araG Arabinose import ATP-binding protein AraG Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q13U53 7.24e-135 402 43 5 496 3 araG Arabinose import ATP-binding protein AraG Paraburkholderia xenovorans (strain LB400)
Q1GHE5 9.95e-135 402 41 3 500 3 rbsA Ribose import ATP-binding protein RbsA Ruegeria sp. (strain TM1040)
Q9WXX0 2.74e-134 401 42 3 505 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q4ZTW1 1.67e-133 399 43 3 495 3 araG Arabinose import ATP-binding protein AraG Pseudomonas syringae pv. syringae (strain B728a)
Q987E7 6.54e-133 397 42 4 492 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q987E7 3.48e-14 78 24 4 234 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q48IS7 1.4e-132 396 43 3 492 3 araG Arabinose import ATP-binding protein AraG Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q398W2 2.46e-132 396 41 2 506 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q3KDW2 3.91e-132 395 42 5 503 3 xylG Xylose import ATP-binding protein XylG Pseudomonas fluorescens (strain Pf0-1)
Q3KDW2 8.28e-13 74 27 7 245 3 xylG Xylose import ATP-binding protein XylG Pseudomonas fluorescens (strain Pf0-1)
Q2K3Y7 8.3e-132 394 42 5 499 3 araG Arabinose import ATP-binding protein AraG Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q0I348 1.41e-131 394 41 4 503 3 xylG Xylose import ATP-binding protein XylG Histophilus somni (strain 129Pt)
Q0I348 1.07e-13 77 27 4 230 3 xylG Xylose import ATP-binding protein XylG Histophilus somni (strain 129Pt)
Q73KK2 3.19e-131 392 40 3 488 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73KK2 8.3e-16 83 24 5 243 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73KK2 1.2e-10 67 23 5 253 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q2T4S8 4.21e-131 393 44 3 492 3 araG2 Arabinose import ATP-binding protein AraG 2 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q880Z2 5.92e-131 393 42 5 501 3 xylG Xylose import ATP-binding protein XylG Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q880Z2 8.77e-13 73 26 7 245 3 xylG Xylose import ATP-binding protein XylG Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q6D4W8 1.02e-130 392 42 4 491 3 araG Arabinose import ATP-binding protein AraG Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D4W8 3.86e-20 96 30 4 236 3 araG Arabinose import ATP-binding protein AraG Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9S472 1.24e-130 392 44 7 501 3 araG L-arabinose transport ATP-binding protein AraG Geobacillus stearothermophilus
Q9S472 1.65e-13 76 26 6 235 3 araG L-arabinose transport ATP-binding protein AraG Geobacillus stearothermophilus
P45046 1.8e-130 391 41 4 500 3 xylG Xylose import ATP-binding protein XylG Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45046 3.09e-14 78 27 4 230 3 xylG Xylose import ATP-binding protein XylG Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q92W56 4.64e-130 390 42 5 495 3 araG Arabinose import ATP-binding protein AraG Rhizobium meliloti (strain 1021)
Q48J74 1.38e-129 389 42 5 501 3 xylG Xylose import ATP-binding protein XylG Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q48J74 9.46e-12 70 26 7 245 3 xylG Xylose import ATP-binding protein XylG Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q0B7X0 5.43e-129 387 41 2 505 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q3JNJ9 6.55e-129 387 43 5 496 3 araG Arabinose import ATP-binding protein AraG Burkholderia pseudomallei (strain 1710b)
Q882I8 8.19e-129 387 42 3 495 3 araG Arabinose import ATP-binding protein AraG Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q2SZC2 1.1e-128 386 43 5 496 3 araG1 Arabinose import ATP-binding protein AraG 1 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63QQ7 1.17e-128 386 43 5 496 3 araG Arabinose import ATP-binding protein AraG Burkholderia pseudomallei (strain K96243)
Q4ZSF3 1.6e-128 386 42 5 501 3 xylG Xylose import ATP-binding protein XylG Pseudomonas syringae pv. syringae (strain B728a)
Q4ZSF3 5.62e-13 74 27 8 248 3 xylG Xylose import ATP-binding protein XylG Pseudomonas syringae pv. syringae (strain B728a)
Q39JR1 4.04e-128 385 42 5 496 3 araG1 Arabinose import ATP-binding protein AraG 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q62GY9 7.81e-128 384 43 5 496 3 araG Arabinose import ATP-binding protein AraG Burkholderia mallei (strain ATCC 23344)
Q3K8M7 1.19e-127 384 42 3 497 3 araG Arabinose import ATP-binding protein AraG Pseudomonas fluorescens (strain Pf0-1)
Q66AF5 1.31e-126 382 42 3 492 3 araG Arabinose import ATP-binding protein AraG Yersinia pseudotuberculosis serotype I (strain IP32953)
Q66AF5 2.69e-18 91 29 5 237 3 araG Arabinose import ATP-binding protein AraG Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CIX6 1.31e-126 382 42 3 492 3 araG Arabinose import ATP-binding protein AraG Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CIX6 2.69e-18 91 29 5 237 3 araG Arabinose import ATP-binding protein AraG Yersinia pestis bv. Antiqua (strain Nepal516)
Q0WER5 1.31e-126 382 42 3 492 3 araG Arabinose import ATP-binding protein AraG Yersinia pestis
Q0WER5 2.69e-18 91 29 5 237 3 araG Arabinose import ATP-binding protein AraG Yersinia pestis
Q1C7J0 1.31e-126 382 42 3 492 3 araG Arabinose import ATP-binding protein AraG Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C7J0 2.69e-18 91 29 5 237 3 araG Arabinose import ATP-binding protein AraG Yersinia pestis bv. Antiqua (strain Antiqua)
Q8XVS2 1.52e-126 381 41 5 499 3 araG Arabinose import ATP-binding protein AraG Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8U949 2.14e-126 380 39 2 494 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
P32721 2.85e-126 380 40 6 507 3 alsA D-allose import ATP-binding protein AlsA Escherichia coli (strain K12)
Q1BZA2 3.54e-125 377 42 5 496 3 araG1 Arabinose import ATP-binding protein AraG 1 Burkholderia orbicola (strain AU 1054)
A0K4E8 3.54e-125 377 42 5 496 3 araG1 Arabinose import ATP-binding protein AraG 1 Burkholderia cenocepacia (strain HI2424)
Q0BIE1 1.38e-124 376 42 5 496 3 araG1 Arabinose import ATP-binding protein AraG 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q322L1 5.06e-124 374 40 3 494 3 araG Arabinose import ATP-binding protein AraG Shigella boydii serotype 4 (strain Sb227)
P0AAF3 5.88e-124 374 40 3 494 1 araG Arabinose import ATP-binding protein AraG Escherichia coli (strain K12)
P0AAF4 5.88e-124 374 40 3 494 3 araG Arabinose import ATP-binding protein AraG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAF5 5.88e-124 374 40 3 494 3 araG Arabinose import ATP-binding protein AraG Escherichia coli O157:H7
Q92UI2 7.88e-124 374 42 3 487 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium meliloti (strain 1021)
Q92UI2 2.55e-19 94 29 7 239 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium meliloti (strain 1021)
Q32HC7 8.05e-124 374 40 3 494 3 araG Arabinose import ATP-binding protein AraG Shigella dysenteriae serotype 1 (strain Sd197)
Q0TGT7 1.23e-123 374 40 3 494 3 araG Arabinose import ATP-binding protein AraG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1RAN8 1.4e-123 373 40 3 494 3 araG Arabinose import ATP-binding protein AraG Escherichia coli (strain UTI89 / UPEC)
Q8G847 1.44e-123 374 40 7 509 1 fruK Fructose import ATP-binding protein FruK Bifidobacterium longum (strain NCC 2705)
Q2SVU4 1.47e-123 373 40 2 505 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q88J90 3.82e-123 372 40 5 502 3 rbsA Ribose import ATP-binding protein RbsA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88J90 7.54e-18 89 26 6 252 3 rbsA Ribose import ATP-binding protein RbsA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q3Z2S7 3.86e-123 372 40 3 494 3 araG Arabinose import ATP-binding protein AraG Shigella sonnei (strain Ss046)
Q1BPL3 1.04e-122 371 41 3 504 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia orbicola (strain AU 1054)
A0B1M7 1.04e-122 371 41 3 504 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia cenocepacia (strain HI2424)
Q56342 2.09e-122 370 39 3 491 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema pallidum (strain Nichols)
Q56342 1.12e-16 86 24 5 246 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema pallidum (strain Nichols)
Q83KP2 5.89e-122 369 40 3 494 3 araG Arabinose import ATP-binding protein AraG Shigella flexneri
Q11C01 5.81e-121 367 41 5 494 3 rbsA Ribose import ATP-binding protein RbsA Chelativorans sp. (strain BNC1)
Q11C01 1.38e-17 89 28 6 230 3 rbsA Ribose import ATP-binding protein RbsA Chelativorans sp. (strain BNC1)
Q3J3V9 4.22e-118 359 39 6 495 3 rbsA Ribose import ATP-binding protein RbsA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q3J3V9 2.65e-17 88 25 6 251 3 rbsA Ribose import ATP-binding protein RbsA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q3J3V9 4.03e-13 75 25 6 242 3 rbsA Ribose import ATP-binding protein RbsA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q62K91 6.58e-117 356 40 3 504 3 rbsA Ribose import ATP-binding protein RbsA Burkholderia mallei (strain ATCC 23344)
P63299 7.99e-117 356 38 4 491 3 ytfR Galactofuranose transporter ATP-binding protein YtfR Escherichia coli O157:H7
P63299 2.01e-15 82 27 3 228 3 ytfR Galactofuranose transporter ATP-binding protein YtfR Escherichia coli O157:H7
Q6BEX0 9e-117 356 38 4 491 1 ytfR Galactofuranose transporter ATP-binding protein YtfR Escherichia coli (strain K12)
Q6BEX0 1.92e-15 82 27 3 228 1 ytfR Galactofuranose transporter ATP-binding protein YtfR Escherichia coli (strain K12)
Q98K15 9.25e-115 351 39 6 497 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q98K15 5.39e-16 84 25 2 224 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q1MHS1 1.07e-114 351 38 6 497 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1MHS1 7.28e-13 74 23 2 229 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q92MP8 9.92e-112 343 41 4 496 3 R02565 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium meliloti (strain 1021)
Q92MP8 8.43e-21 99 28 5 243 3 R02565 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium meliloti (strain 1021)
Q92MP8 4.04e-15 81 29 4 209 3 R02565 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium meliloti (strain 1021)
Q3JSI8 2.52e-111 352 40 3 504 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia pseudomallei (strain 1710b)
Q7N2D9 2.9e-109 337 38 6 508 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7N2D9 3.14e-16 84 25 6 238 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q1QYT1 1.8e-107 332 38 7 497 3 araG Arabinose import ATP-binding protein AraG Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q2K9A3 1.04e-106 330 38 6 497 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2K9A3 5.22e-12 71 22 2 229 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2PBM0 4.2e-105 326 37 6 508 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus luminescens
Q2PBM0 7.2e-16 83 25 7 250 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus luminescens
Q2PBM3 3.27e-102 319 37 8 510 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus temperata
Q2PBM3 1.48e-17 89 26 5 231 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus temperata
A1JJ55 2.32e-101 317 37 9 518 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
O05253 3.09e-101 316 36 5 509 1 nupO Guanosine import ATP-binding protein NupO Bacillus subtilis (strain 168)
P77257 3.74e-101 316 38 8 506 1 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain K12)
B1XEA1 3.74e-101 316 38 8 506 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain K12 / DH10B)
B1LFA2 6.67e-101 315 38 8 506 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain SMS-3-5 / SECEC)
B1IRU7 4.97e-100 313 38 8 506 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8XAY7 8.51e-100 312 38 8 506 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli O157:H7
Q66EY9 9.11e-100 313 37 7 509 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q66EY9 2.99e-16 85 25 5 235 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K3G1 9.11e-100 313 37 7 509 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B2K3G1 2.99e-16 85 25 5 235 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q0T4L9 1.03e-99 312 38 9 507 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Shigella flexneri serotype 5b (strain 8401)
B1JLQ0 1.23e-99 312 37 7 509 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
B1JLQ0 3.13e-16 84 25 5 235 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q83L12 1.36e-99 312 38 9 507 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Shigella flexneri
A4TQL5 1.37e-99 312 37 6 514 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis (strain Pestoides F)
A4TQL5 1.6e-16 85 25 5 235 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis (strain Pestoides F)
Q1CN15 1.37e-99 312 37 6 514 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CN15 1.6e-16 85 25 5 235 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R074 1.37e-99 312 37 6 514 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis bv. Antiqua (strain Angola)
A9R074 1.6e-16 85 25 5 235 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis bv. Antiqua (strain Angola)
Q0WJP9 1.37e-99 312 37 6 514 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis
Q0WJP9 1.6e-16 85 25 5 235 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis
Q1C138 1.37e-99 312 37 6 514 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C138 1.6e-16 85 25 5 235 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMJ7 2.2e-99 312 37 7 509 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A7FMJ7 3.21e-16 84 25 5 235 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8A066 8.55e-99 310 38 8 506 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli O9:H4 (strain HS)
A6TEB8 1.94e-97 306 36 6 507 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A4WER4 1.04e-95 301 37 6 507 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Enterobacter sp. (strain 638)
P77509 2.34e-95 301 36 10 499 3 yphE Uncharacterized ABC transporter ATP-binding protein YphE Escherichia coli (strain K12)
P77509 1.91e-14 79 25 5 232 3 yphE Uncharacterized ABC transporter ATP-binding protein YphE Escherichia coli (strain K12)
Q8Z2X5 2.78e-95 301 34 8 512 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella typhi
D4GPW3 5.6e-95 301 34 7 522 3 tsgD13 Glucose import ATP-binding protein TsgD13 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
D4GPW3 3.92e-15 81 27 7 263 3 tsgD13 Glucose import ATP-binding protein TsgD13 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q8ZKQ4 1.09e-94 299 34 8 512 1 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9MZG1 1.14e-94 299 34 8 512 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJE7 1.14e-94 299 34 8 512 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P0C886 1.56e-94 299 34 8 512 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella choleraesuis (strain SC-B67)
A2RKA7 1.64e-84 273 33 6 509 1 nupA Nucleoside import ATP-binding protein NupA Lactococcus lactis subsp. cremoris (strain MG1363)
A2RKA7 2.92e-19 94 26 4 249 1 nupA Nucleoside import ATP-binding protein NupA Lactococcus lactis subsp. cremoris (strain MG1363)
P55570 1.06e-73 244 33 11 491 3 NGR_a02480 Uncharacterized ABC transporter ATP-binding protein y4mK Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A7ZLX1 9.73e-59 200 39 4 310 5 lsrA Putative autoinducer 2 import ATP-binding protein LsrA homolog Escherichia coli O139:H28 (strain E24377A / ETEC)
A7ZLX1 3.93e-18 89 28 5 240 5 lsrA Putative autoinducer 2 import ATP-binding protein LsrA homolog Escherichia coli O139:H28 (strain E24377A / ETEC)
P0DTT6 8.43e-45 160 38 2 238 1 xylG Xylose/arabinose import ATP-binding protein XylG Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
P0DTT6 5.11e-16 81 27 4 216 1 xylG Xylose/arabinose import ATP-binding protein XylG Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q9F9B0 6.42e-44 159 35 2 248 1 frcA Fructose import ATP-binding protein FrcA Rhizobium meliloti
Q9F9B0 3.38e-20 93 32 5 208 1 frcA Fructose import ATP-binding protein FrcA Rhizobium meliloti
P75516 1.09e-40 157 33 4 271 3 MPN_258 Putative carbohydrate transport ATP-binding protein MPN_258 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P75516 3.1e-20 97 30 8 258 3 MPN_258 Putative carbohydrate transport ATP-binding protein MPN_258 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P75516 2.55e-12 72 23 4 235 3 MPN_258 Putative carbohydrate transport ATP-binding protein MPN_258 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47365 3.4e-37 147 34 2 243 3 MG119 Putative carbohydrate transport ATP-binding protein MG119 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P47365 2e-20 98 28 3 221 3 MG119 Putative carbohydrate transport ATP-binding protein MG119 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P47365 3e-12 72 25 3 232 3 MG119 Putative carbohydrate transport ATP-binding protein MG119 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P47365 1.26e-05 51 20 3 206 3 MG119 Putative carbohydrate transport ATP-binding protein MG119 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q8G838 5.29e-35 142 25 16 509 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8G838 1.43e-13 77 26 6 228 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8G838 8.65e-13 74 29 5 227 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8TQW9 2.5e-29 124 25 16 507 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQW9 4.85e-17 87 26 4 225 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8PUE7 1.63e-27 119 25 16 492 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PUE7 2.19e-14 79 25 4 224 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PUE7 2.26e-08 60 32 3 112 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q0C1C3 3.94e-27 112 31 5 228 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Hyphomonas neptunium (strain ATCC 15444)
Q0C1C3 9.72e-10 62 28 10 201 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Hyphomonas neptunium (strain ATCC 15444)
P0A9S9 5.5e-27 112 30 6 230 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Shigella flexneri
P0A9S9 4.75e-13 72 27 6 229 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Shigella flexneri
P0A9S7 5.5e-27 112 30 6 230 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Escherichia coli (strain K12)
P0A9S7 4.75e-13 72 27 6 229 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Escherichia coli (strain K12)
P0A9S8 5.5e-27 112 30 6 230 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Escherichia coli O157:H7
P0A9S8 4.75e-13 72 27 6 229 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Escherichia coli O157:H7
Q897I2 6.5e-27 116 27 11 417 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q897I2 1.45e-13 76 29 3 188 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q83LR7 9.16e-27 117 31 4 234 3 macB Macrolide export ATP-binding/permease protein MacB Shigella flexneri
Q83LR7 4.54e-12 72 26 11 242 3 macB Macrolide export ATP-binding/permease protein MacB Shigella flexneri
Q73P93 1.22e-26 116 22 14 500 3 TDE_0906 Putative ABC transporter ATP-binding protein TDE_0906 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73P93 7.41e-13 74 24 5 226 3 TDE_0906 Putative ABC transporter ATP-binding protein TDE_0906 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q81CT8 1.37e-26 116 25 17 526 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81CT8 1.59e-16 85 26 2 223 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q44848 5.29e-26 114 23 12 498 3 BB_0318 Uncharacterized ABC transporter ATP-binding protein BB_0318 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q6G2E2 6.6e-26 111 28 6 289 3 metN Methionine import ATP-binding protein MetN Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q6G2E2 8.71e-15 79 29 6 213 3 metN Methionine import ATP-binding protein MetN Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q1LQF6 1.13e-25 111 28 7 282 3 metN Methionine import ATP-binding protein MetN Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q1LQF6 1.21e-14 78 29 7 214 3 metN Methionine import ATP-binding protein MetN Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q0KDG3 1.45e-25 110 29 7 282 3 metN Methionine import ATP-binding protein MetN Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q0KDG3 2.35e-14 77 28 6 216 3 metN Methionine import ATP-binding protein MetN Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q9CM47 1.58e-25 114 32 5 235 3 macB Macrolide export ATP-binding/permease protein MacB Pasteurella multocida (strain Pm70)
Q9CM47 6.74e-10 65 24 5 214 3 macB Macrolide export ATP-binding/permease protein MacB Pasteurella multocida (strain Pm70)
Q58663 2.81e-25 107 30 3 250 1 livG Probable branched-chain amino acid transport ATP-binding protein LivG Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q58663 5.81e-14 75 26 3 216 1 livG Probable branched-chain amino acid transport ATP-binding protein LivG Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A1K323 3.15e-25 113 31 5 227 3 macB Macrolide export ATP-binding/permease protein MacB Azoarcus sp. (strain BH72)
A1K323 8.45e-12 71 28 8 218 3 macB Macrolide export ATP-binding/permease protein MacB Azoarcus sp. (strain BH72)
Q8XED0 4.92e-25 112 31 4 234 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O157:H7
Q8XED0 8.36e-11 68 25 8 236 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O157:H7
A0KMJ3 4.95e-25 112 31 5 235 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A0KMJ3 7.59e-11 68 27 9 216 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q0TJH0 4.96e-25 112 30 4 239 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TJH0 1.59e-11 70 26 8 236 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1RE44 5.15e-25 112 30 4 239 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain UTI89 / UPEC)
Q1RE44 1.55e-11 70 26 8 236 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain UTI89 / UPEC)
A1A9B7 5.15e-25 112 30 4 239 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Escherichia coli O1:K1 / APEC
A1A9B7 1.55e-11 70 26 8 236 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Escherichia coli O1:K1 / APEC
Q81PZ8 6.21e-25 111 23 19 538 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q6MIP7 6.67e-25 107 29 6 240 3 phnC Phosphonates import ATP-binding protein PhnC Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q6MIP7 4.52e-07 54 22 6 245 3 phnC Phosphonates import ATP-binding protein PhnC Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q3Z3Q4 6.76e-25 112 31 4 234 3 macB Macrolide export ATP-binding/permease protein MacB Shigella sonnei (strain Ss046)
Q3Z3Q4 1.24e-11 70 26 8 236 3 macB Macrolide export ATP-binding/permease protein MacB Shigella sonnei (strain Ss046)
P75831 7.14e-25 112 31 4 234 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain K12)
P75831 1.87e-11 70 26 8 236 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain K12)
O34362 7.66e-25 111 24 15 503 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
O34362 2.8e-08 60 26 9 230 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
Q12B04 9.02e-25 108 31 5 255 3 metN Methionine import ATP-binding protein MetN Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q12B04 8.99e-14 76 30 7 210 3 metN Methionine import ATP-binding protein MetN Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q9TKX3 1.12e-24 108 30 3 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nephroselmis olivacea
Q9TKX3 1.33e-11 69 25 5 204 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nephroselmis olivacea
P0AAF9 1.25e-24 105 31 3 231 3 artP Arginine transport ATP-binding protein ArtP Shigella flexneri
P0AAF9 2.25e-11 67 25 6 212 3 artP Arginine transport ATP-binding protein ArtP Shigella flexneri
P0AAF6 1.25e-24 105 31 3 231 1 artP Arginine transport ATP-binding protein ArtP Escherichia coli (strain K12)
P0AAF6 2.25e-11 67 25 6 212 1 artP Arginine transport ATP-binding protein ArtP Escherichia coli (strain K12)
P0AAF7 1.25e-24 105 31 3 231 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAF7 2.25e-11 67 25 6 212 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAF8 1.25e-24 105 31 3 231 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O157:H7
P0AAF8 2.25e-11 67 25 6 212 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O157:H7
Q323M3 1.48e-24 110 31 4 234 3 macB Macrolide export ATP-binding/permease protein MacB Shigella boydii serotype 4 (strain Sb227)
Q323M3 9.12e-11 68 25 8 236 3 macB Macrolide export ATP-binding/permease protein MacB Shigella boydii serotype 4 (strain Sb227)
Q32DZ9 1.6e-24 110 31 4 231 3 macB Macrolide export ATP-binding/permease protein MacB Shigella dysenteriae serotype 1 (strain Sd197)
Q32DZ9 2.99e-11 69 25 8 236 3 macB Macrolide export ATP-binding/permease protein MacB Shigella dysenteriae serotype 1 (strain Sd197)
P56344 1.89e-24 105 28 4 239 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
P56344 4.79e-11 66 23 5 204 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
Q9MUN1 2.88e-24 107 30 3 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
Q9MUN1 5.15e-13 73 26 6 210 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
Q8F6Z1 3.83e-24 107 29 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q8F6Z1 9.79e-14 76 23 5 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PE5 3.83e-24 107 29 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q72PE5 9.79e-14 76 23 5 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q46Y69 3.91e-24 106 28 7 282 3 metN Methionine import ATP-binding protein MetN Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q46Y69 8.25e-16 82 29 5 216 3 metN Methionine import ATP-binding protein MetN Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q7W9U5 3.94e-24 107 25 4 282 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7W9U5 1.55e-13 75 25 5 205 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q8KLG1 4.12e-24 105 29 6 245 3 nodI Nod factor export ATP-binding protein I Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8KLG1 6.35e-14 76 26 5 230 3 nodI Nod factor export ATP-binding protein I Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q7WGW1 4.68e-24 106 25 4 282 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7WGW1 1.53e-13 75 25 5 205 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8ES39 5.03e-24 108 24 15 508 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q7VZE5 5.15e-24 106 25 4 282 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7VZE5 1.7e-13 75 25 5 205 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8YUV1 7.45e-24 103 28 3 241 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8YUV1 2.17e-08 58 25 5 213 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P45073 9.7e-24 103 25 1 218 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45073 2.49e-17 84 26 5 230 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q0SFY5 1.04e-23 105 30 4 243 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodococcus jostii (strain RHA1)
Q0SFY5 3.85e-14 77 29 6 211 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodococcus jostii (strain RHA1)
P0A193 1.13e-23 103 29 6 230 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A193 6.89e-15 78 29 6 229 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A194 1.13e-23 103 29 6 230 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Salmonella typhi
P0A194 6.89e-15 78 29 6 229 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Salmonella typhi
P37624 1.18e-23 108 25 19 512 1 rbbA Ribosome-associated ATPase Escherichia coli (strain K12)
P37624 3.34e-13 75 25 4 227 1 rbbA Ribosome-associated ATPase Escherichia coli (strain K12)
Q1IGZ0 1.18e-23 105 30 7 238 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas entomophila (strain L48)
Q1IGZ0 9.56e-14 75 26 5 209 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas entomophila (strain L48)
Q0BH79 1.21e-23 105 30 7 273 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q0BH79 1.44e-17 87 29 4 214 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
P21629 1.32e-23 103 30 4 228 3 braF High-affinity branched-chain amino acid transport ATP-binding protein BraF Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P21629 7.39e-17 83 26 4 225 3 braF High-affinity branched-chain amino acid transport ATP-binding protein BraF Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8PC11 1.39e-23 105 30 4 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8PC11 1.09e-14 79 26 8 211 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9A502 1.68e-23 104 33 3 206 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9A502 2.91e-15 80 30 6 210 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q21XK2 1.87e-23 104 31 4 229 3 metN Methionine import ATP-binding protein MetN Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q21XK2 4.77e-09 61 39 1 79 3 metN Methionine import ATP-binding protein MetN Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q88RL5 2.13e-23 104 31 4 217 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88RL5 3.78e-14 77 29 7 210 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P46903 2.41e-23 102 32 4 206 1 natA ABC transporter ATP-binding protein NatA Bacillus subtilis (strain 168)
P46903 2.23e-18 87 28 3 214 1 natA ABC transporter ATP-binding protein NatA Bacillus subtilis (strain 168)
Q8PNN4 2.58e-23 104 29 3 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas axonopodis pv. citri (strain 306)
Q8PNN4 7.73e-14 76 25 7 211 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas axonopodis pv. citri (strain 306)
Q7VI92 2.76e-23 104 30 5 231 3 metN Methionine import ATP-binding protein MetN Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q7VI92 1.32e-12 72 27 7 217 3 metN Methionine import ATP-binding protein MetN Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q8Z0H0 2.92e-23 103 29 3 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8Z0H0 2.37e-13 74 25 7 222 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q9AB70 3.15e-23 102 28 5 246 3 phnC Phosphonates import ATP-binding protein PhnC Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9AB70 1.29e-07 56 24 5 230 3 phnC Phosphonates import ATP-binding protein PhnC Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q1BY14 3.2e-23 103 28 6 273 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia orbicola (strain AU 1054)
Q1BY14 4e-17 86 29 4 214 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia orbicola (strain AU 1054)
A0K5N5 3.2e-23 103 28 6 273 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia cenocepacia (strain HI2424)
A0K5N5 4e-17 86 29 4 214 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia cenocepacia (strain HI2424)
Q7N8M2 3.93e-23 103 31 4 232 3 metN Methionine import ATP-binding protein MetN Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7N8M2 4.64e-13 73 28 5 209 3 metN Methionine import ATP-binding protein MetN Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6RCE0 4.72e-23 102 29 8 258 3 phnC Phosphonates import ATP-binding protein PhnC Stutzerimonas stutzeri
Q6RCE0 2.19e-06 52 22 6 215 3 phnC Phosphonates import ATP-binding protein PhnC Stutzerimonas stutzeri
Q882S0 5.67e-23 102 27 5 248 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q882S0 8.71e-10 63 24 7 231 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8DIA0 5.98e-23 103 29 3 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8DIA0 1.72e-13 75 25 7 208 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8XK20 6.49e-23 105 24 19 536 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8XK20 3.16e-18 91 30 7 239 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q667L9 7.24e-23 102 32 5 232 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q667L9 6.49e-15 79 30 6 209 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q17VE0 7.41e-23 102 28 4 229 3 metN Methionine import ATP-binding protein MetN Helicobacter acinonychis (strain Sheeba)
Q17VE0 5.57e-10 64 25 7 220 3 metN Methionine import ATP-binding protein MetN Helicobacter acinonychis (strain Sheeba)
Q7NIW1 7.49e-23 102 29 3 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q7NIW1 1.78e-11 68 24 7 209 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q6D1C4 7.97e-23 102 31 5 232 3 metN3 Methionine import ATP-binding protein MetN 3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D1C4 4.31e-13 73 28 6 210 3 metN3 Methionine import ATP-binding protein MetN 3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q39IE7 8.73e-23 102 28 6 273 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q39IE7 1.05e-14 79 28 4 214 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q88WA5 8.95e-23 102 30 5 237 3 metN1 Methionine import ATP-binding protein MetN 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88WA5 1.14e-20 96 30 4 213 3 metN1 Methionine import ATP-binding protein MetN 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q97KD5 1.05e-22 102 28 3 217 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q97KD5 8.95e-13 72 29 5 226 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q65VG9 1.17e-22 102 30 5 240 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q65VG9 5.12e-13 73 30 10 224 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8PGE8 1.19e-22 102 31 4 216 3 metN Methionine import ATP-binding protein MetN Xanthomonas axonopodis pv. citri (strain 306)
Q8PGE8 4.66e-12 70 28 6 213 3 metN Methionine import ATP-binding protein MetN Xanthomonas axonopodis pv. citri (strain 306)
Q5WVL8 1.21e-22 102 29 4 249 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Lens)
Q5WVL8 5.28e-13 73 30 4 215 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Lens)
Q8ZQE4 1.35e-22 105 30 4 234 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZQE4 6.01e-15 81 26 6 243 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z824 1.37e-22 105 30 4 234 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhi
Q8Z824 5.6e-15 81 26 6 243 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhi
Q5PGK9 1.43e-22 104 30 4 234 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PGK9 6.01e-15 81 26 6 243 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q3YUN6 1.51e-22 100 28 6 230 3 phnC Phosphonates import ATP-binding protein PhnC Shigella sonnei (strain Ss046)
Q3YUN6 4.72e-12 69 22 8 244 3 phnC Phosphonates import ATP-binding protein PhnC Shigella sonnei (strain Ss046)
Q8P4S7 1.53e-22 102 30 5 217 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8P4S7 3.2e-12 71 27 7 214 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UQD2 1.53e-22 102 30 5 217 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain 8004)
Q4UQD2 3.2e-12 71 27 7 214 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain 8004)
Q1GIE5 1.57e-22 102 33 4 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Ruegeria sp. (strain TM1040)
Q1GIE5 1.53e-14 78 24 4 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Ruegeria sp. (strain TM1040)
P96605 1.58e-22 101 27 4 239 3 ydbJ Uncharacterized ABC transporter ATP-binding protein YdbJ Bacillus subtilis (strain 168)
P96605 3.47e-15 79 27 5 222 3 ydbJ Uncharacterized ABC transporter ATP-binding protein YdbJ Bacillus subtilis (strain 168)
Q8UCD5 1.78e-22 102 29 3 203 3 modC Molybdenum import ATP-binding protein ModC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8UCD5 4.87e-16 83 27 8 221 3 modC Molybdenum import ATP-binding protein ModC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q92WJ0 2.11e-22 101 28 3 225 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhizobium meliloti (strain 1021)
Q92WJ0 8.71e-15 79 27 6 211 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhizobium meliloti (strain 1021)
Q5ZUG5 2.11e-22 101 28 4 249 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5ZUG5 3.8e-13 73 30 4 215 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X484 2.11e-22 101 28 4 249 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Paris)
Q5X484 1.04e-13 75 31 6 217 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Paris)
Q6NJ07 2.12e-22 101 29 7 281 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q6NJ07 1.78e-14 78 28 6 225 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q5LUD0 2.56e-22 99 31 6 231 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q5LUD0 1.94e-07 55 36 2 82 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q8Y0X3 2.77e-22 101 28 7 278 3 metN Methionine import ATP-binding protein MetN Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8Y0X3 7.78e-17 85 30 5 217 3 metN Methionine import ATP-binding protein MetN Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q4ZU82 3.18e-22 99 28 6 253 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. syringae (strain B728a)
Q4ZU82 9.33e-09 60 23 7 231 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. syringae (strain B728a)
Q38WL5 3.69e-22 100 30 5 250 3 metN Methionine import ATP-binding protein MetN Latilactobacillus sakei subsp. sakei (strain 23K)
Q38WL5 4.61e-16 82 29 6 219 3 metN Methionine import ATP-binding protein MetN Latilactobacillus sakei subsp. sakei (strain 23K)
Q3BNZ3 3.8e-22 100 29 3 215 3 metN Methionine import ATP-binding protein MetN Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q3BNZ3 1.52e-11 69 27 7 214 3 metN Methionine import ATP-binding protein MetN Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q110U3 3.8e-22 101 32 6 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichodesmium erythraeum (strain IMS101)
Q110U3 2.08e-12 72 23 5 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichodesmium erythraeum (strain IMS101)
Q9ZJ34 4.24e-22 100 29 5 231 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain J99 / ATCC 700824)
Q9ZJ34 3.95e-10 64 25 6 220 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain J99 / ATCC 700824)
O28881 4.29e-22 99 26 4 245 3 livG Probable branched-chain amino acid transport ATP-binding protein LivG Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O28881 8.87e-09 60 26 4 217 3 livG Probable branched-chain amino acid transport ATP-binding protein LivG Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q0I5E9 4.36e-22 100 27 6 288 3 metN Methionine import ATP-binding protein MetN Histophilus somni (strain 129Pt)
Q0I5E9 1.32e-15 81 29 7 219 3 metN Methionine import ATP-binding protein MetN Histophilus somni (strain 129Pt)
Q81IZ6 4.38e-22 100 31 4 232 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81IZ6 4.89e-14 77 28 5 224 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q2KVK2 4.63e-22 100 29 5 226 3 metN Methionine import ATP-binding protein MetN Bordetella avium (strain 197N)
Q2KVK2 2.58e-07 56 25 7 210 3 metN Methionine import ATP-binding protein MetN Bordetella avium (strain 197N)
Q02ME3 4.79e-22 100 30 5 233 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q02ME3 3.45e-13 74 28 6 211 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q93DX8 4.98e-22 99 26 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q93DX8 5.62e-12 69 26 7 207 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q57R58 5.01e-22 103 29 4 234 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella choleraesuis (strain SC-B67)
Q57R58 3.97e-15 81 26 6 245 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella choleraesuis (strain SC-B67)
Q67JX4 5.3e-22 99 32 4 212 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q67JX4 1.89e-11 68 27 5 209 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q48HL2 5.31e-22 99 28 5 248 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q48HL2 1.2e-09 62 24 7 231 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
P36879 5.45e-22 99 27 6 255 1 yadG Uncharacterized ABC transporter ATP-binding protein YadG Escherichia coli (strain K12)
P36879 4.92e-09 61 33 1 95 1 yadG Uncharacterized ABC transporter ATP-binding protein YadG Escherichia coli (strain K12)
Q1DDP4 5.53e-22 100 27 4 232 3 metN Methionine import ATP-binding protein MetN Myxococcus xanthus (strain DK1622)
Q1DDP4 4.44e-11 67 26 6 214 3 metN Methionine import ATP-binding protein MetN Myxococcus xanthus (strain DK1622)
Q1CFH7 5.58e-22 100 31 5 232 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CFH7 4.03e-14 77 29 6 209 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZH38 5.58e-22 100 31 5 232 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis
Q8ZH38 4.03e-14 77 29 6 209 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis
Q1CAK4 5.58e-22 100 31 5 232 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Antiqua)
Q1CAK4 4.03e-14 77 29 6 209 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Antiqua)
Q7N6Z2 5.93e-22 100 29 4 219 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7N6Z2 5.84e-15 79 26 6 207 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q13VD7 6.41e-22 100 28 6 273 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
Q13VD7 4.63e-14 77 27 6 214 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
Q87DT9 6.52e-22 100 29 3 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q87DT9 1.53e-15 81 25 6 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q080S4 6.69e-22 97 30 6 214 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella frigidimarina (strain NCIMB 400)
Q080S4 2.15e-12 70 28 7 210 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella frigidimarina (strain NCIMB 400)
Q1LPJ9 6.92e-22 98 31 6 231 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q1LPJ9 1.41e-06 53 33 2 84 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
O68106 8.18e-22 98 27 7 281 1 cbiO Cobalt import ATP-binding protein CbiO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
O68106 5.24e-16 81 27 5 231 1 cbiO Cobalt import ATP-binding protein CbiO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q0T9T7 9.42e-22 98 27 6 230 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0T9T7 6.98e-12 69 22 8 244 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
O26096 9.64e-22 99 29 5 231 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain ATCC 700392 / 26695)
O26096 2.67e-10 65 25 6 220 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain ATCC 700392 / 26695)
Q0ASQ1 1.05e-21 97 27 6 248 3 phnC Phosphonates import ATP-binding protein PhnC Maricaulis maris (strain MCS10)
Q0ASQ1 2.08e-09 62 25 4 226 3 phnC Phosphonates import ATP-binding protein PhnC Maricaulis maris (strain MCS10)
Q609Q1 1.05e-21 99 29 3 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q609Q1 5.3e-14 76 26 6 219 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q329I3 1.06e-21 97 27 5 230 3 phnC Phosphonates import ATP-binding protein PhnC Shigella dysenteriae serotype 1 (strain Sd197)
Q329I3 7.64e-11 66 23 9 233 3 phnC Phosphonates import ATP-binding protein PhnC Shigella dysenteriae serotype 1 (strain Sd197)
Q9CK97 1.12e-21 99 30 5 234 3 metN Methionine import ATP-binding protein MetN Pasteurella multocida (strain Pm70)
Q9CK97 3.1e-13 74 28 7 218 3 metN Methionine import ATP-binding protein MetN Pasteurella multocida (strain Pm70)
Q7UPK3 1.31e-21 97 35 9 227 3 lolD2 Lipoprotein-releasing system ATP-binding protein LolD 2 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q7UPK3 1.11e-06 53 37 2 77 3 lolD2 Lipoprotein-releasing system ATP-binding protein LolD 2 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q7M8U0 1.38e-21 101 32 5 225 3 macB Macrolide export ATP-binding/permease protein MacB Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q7M8U0 1.79e-08 60 39 1 79 3 macB Macrolide export ATP-binding/permease protein MacB Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q4KKK8 1.39e-21 99 28 5 233 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4KKK8 1.14e-12 72 27 7 220 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9G4F5 1.41e-21 99 26 2 215 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
Q9G4F5 2.87e-15 80 26 6 220 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
Q9PDN2 1.43e-21 99 27 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain 9a5c)
Q9PDN2 6.1e-16 82 26 5 205 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain 9a5c)
Q8EEV5 1.58e-21 96 31 6 209 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8EEV5 1.74e-11 67 28 8 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q1CR30 1.63e-21 99 29 5 231 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain HPAG1)
Q1CR30 3.03e-10 65 25 6 220 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain HPAG1)
Q2P7S3 1.7e-21 99 29 3 215 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q2P7S3 2.25e-10 65 26 7 212 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8FV85 1.78e-21 99 30 3 226 3 metN Methionine import ATP-binding protein MetN Brucella suis biovar 1 (strain 1330)
Q8FV85 4.16e-14 77 29 7 214 3 metN Methionine import ATP-binding protein MetN Brucella suis biovar 1 (strain 1330)
Q8YD40 1.78e-21 99 30 3 226 3 metN Methionine import ATP-binding protein MetN Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8YD40 4.16e-14 77 29 7 214 3 metN Methionine import ATP-binding protein MetN Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q579H8 1.78e-21 99 30 3 226 3 metN Methionine import ATP-binding protein MetN Brucella abortus biovar 1 (strain 9-941)
Q579H8 4.16e-14 77 29 7 214 3 metN Methionine import ATP-binding protein MetN Brucella abortus biovar 1 (strain 9-941)
Q2YIV5 1.78e-21 99 30 3 226 3 metN Methionine import ATP-binding protein MetN Brucella abortus (strain 2308)
Q2YIV5 4.16e-14 77 29 7 214 3 metN Methionine import ATP-binding protein MetN Brucella abortus (strain 2308)
Q8E3S0 1.86e-21 99 28 8 289 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype III (strain NEM316)
Q8E3S0 1.04e-15 82 28 5 212 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype III (strain NEM316)
Q86UQ4 1.88e-21 102 29 5 217 1 ABCA13 ATP-binding cassette sub-family A member 13 Homo sapiens
Q86UQ4 1.21e-14 80 26 5 219 1 ABCA13 ATP-binding cassette sub-family A member 13 Homo sapiens
Q86UQ4 4.39e-13 75 28 8 229 1 ABCA13 ATP-binding cassette sub-family A member 13 Homo sapiens
Q86UQ4 1.09e-08 62 26 4 215 1 ABCA13 ATP-binding cassette sub-family A member 13 Homo sapiens
Q9WYI7 1.91e-21 96 30 5 229 3 TM_0352 Uncharacterized ABC transporter ATP-binding protein TM_0352 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9WYI7 7.37e-09 59 28 10 218 3 TM_0352 Uncharacterized ABC transporter ATP-binding protein TM_0352 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q8RQL7 1.92e-21 96 28 2 218 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8RQL7 1.82e-13 73 25 5 211 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q82WT5 1.97e-21 99 26 4 247 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q82WT5 1.45e-15 81 26 6 221 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P16677 2.06e-21 97 26 6 235 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain K12)
P16677 3.43e-11 67 25 10 248 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain K12)
O34814 2.08e-21 96 28 3 217 1 ftsE Cell division ATP-binding protein FtsE Bacillus subtilis (strain 168)
O34814 4.06e-13 72 28 7 218 1 ftsE Cell division ATP-binding protein FtsE Bacillus subtilis (strain 168)
P94440 2.09e-21 98 29 6 240 1 lnrL Linearmycin resistance ATP-binding protein LnrL Bacillus subtilis (strain 168)
P94440 8.96e-17 84 28 3 206 1 lnrL Linearmycin resistance ATP-binding protein LnrL Bacillus subtilis (strain 168)
Q0HVQ0 2.12e-21 96 31 6 209 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella sp. (strain MR-7)
Q0HVQ0 1.26e-11 67 27 7 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella sp. (strain MR-7)
Q1R3F6 2.14e-21 97 26 4 230 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain UTI89 / UPEC)
Q1R3F6 2.18e-11 67 22 8 244 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain UTI89 / UPEC)
Q5H503 2.2e-21 98 29 3 215 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q5H503 1.33e-10 66 26 7 212 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q73F11 2.24e-21 98 30 4 232 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q73F11 4.93e-13 73 29 5 210 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8DY54 2.27e-21 99 28 8 289 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8DY54 1.56e-15 81 28 5 212 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3JZP8 2.27e-21 99 28 8 289 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q3JZP8 1.56e-15 81 28 5 212 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8FAV1 2.27e-21 97 26 4 230 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FAV1 4.76e-11 66 23 8 232 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q73P71 2.36e-21 96 27 7 243 3 phnC Phosphonates import ATP-binding protein PhnC Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73P71 6.89e-13 72 24 7 236 3 phnC Phosphonates import ATP-binding protein PhnC Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
A1U0A9 2.51e-21 100 31 7 243 3 macB Macrolide export ATP-binding/permease protein MacB Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A1U0A9 2.68e-09 63 25 7 243 3 macB Macrolide export ATP-binding/permease protein MacB Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q8UH62 2.54e-21 98 27 2 215 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8UH62 2.53e-14 77 26 6 218 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9K876 2.62e-21 98 26 7 286 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9K876 2.24e-16 84 28 8 221 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q827Y0 2.65e-21 98 29 4 221 3 metN Methionine import ATP-binding protein MetN Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q827Y0 2.21e-13 75 31 8 229 3 metN Methionine import ATP-binding protein MetN Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q0HJG0 2.89e-21 95 31 6 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella sp. (strain MR-4)
Q0HJG0 2.38e-12 70 28 7 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella sp. (strain MR-4)
P10346 3.08e-21 95 29 4 203 1 glnQ Glutamine transport ATP-binding protein GlnQ Escherichia coli (strain K12)
P10346 2.15e-13 73 26 8 225 1 glnQ Glutamine transport ATP-binding protein GlnQ Escherichia coli (strain K12)
Q63S19 3.22e-21 98 27 7 273 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain K96243)
Q63S19 7.25e-16 82 29 6 214 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain K96243)
Q3JPZ4 3.22e-21 98 27 7 273 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain 1710b)
Q3JPZ4 7.25e-16 82 29 6 214 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain 1710b)
Q62M41 3.22e-21 98 27 7 273 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia mallei (strain ATCC 23344)
Q62M41 7.25e-16 82 29 6 214 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia mallei (strain ATCC 23344)
Q8UA73 3.49e-21 98 27 4 217 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8UA73 1.11e-13 75 24 7 222 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2K8C8 3.56e-21 98 26 4 241 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2K8C8 1.06e-11 69 25 6 209 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q63H29 3.57e-21 98 30 4 232 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ZK / E33L)
Q63H29 3.52e-13 74 30 7 213 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ZK / E33L)
P9WQL3 3.97e-21 98 31 4 212 1 modC Molybdenum import ATP-binding protein ModC Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQL3 2.32e-14 78 29 8 216 1 modC Molybdenum import ATP-binding protein ModC Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQL2 3.97e-21 98 31 4 212 3 modC Molybdenum import ATP-binding protein ModC Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WQL2 2.32e-14 78 29 8 216 3 modC Molybdenum import ATP-binding protein ModC Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A9V4 4.12e-21 95 24 1 227 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Shigella flexneri
P0A9V4 3.96e-14 75 24 5 227 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Shigella flexneri
P0A9V1 4.12e-21 95 24 1 227 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli (strain K12)
P0A9V1 3.96e-14 75 24 5 227 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli (strain K12)
P0A9V2 4.12e-21 95 24 1 227 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9V2 3.96e-14 75 24 5 227 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9V3 4.12e-21 95 24 1 227 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli O157:H7
P0A9V3 3.96e-14 75 24 5 227 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli O157:H7
Q6LN52 4.32e-21 97 27 5 256 3 metN Methionine import ATP-binding protein MetN Photobacterium profundum (strain SS9)
Q6LN52 2.33e-12 71 28 7 211 3 metN Methionine import ATP-binding protein MetN Photobacterium profundum (strain SS9)
Q89UD2 4.49e-21 97 26 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q89UD2 3.25e-13 74 27 7 207 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q03A07 4.51e-21 97 31 6 245 3 metN Methionine import ATP-binding protein MetN Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q03A07 5.42e-16 82 29 5 218 3 metN Methionine import ATP-binding protein MetN Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q1I7I9 4.88e-21 100 30 4 233 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas entomophila (strain L48)
Q1I7I9 4.15e-10 65 28 9 222 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas entomophila (strain L48)
Q39GT7 4.99e-21 97 27 3 226 3 nodI Nod factor export ATP-binding protein I Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q39GT7 4.3e-18 88 29 4 211 3 nodI Nod factor export ATP-binding protein I Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q9I1C8 5.02e-21 98 30 6 233 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9I1C8 2.11e-12 72 27 6 211 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q57S53 5.23e-21 97 29 3 206 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella choleraesuis (strain SC-B67)
Q57S53 7.57e-15 79 27 6 223 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella choleraesuis (strain SC-B67)
Q7VV72 5.67e-21 97 29 3 206 3 metN Methionine import ATP-binding protein MetN Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7VV72 4.28e-08 58 24 6 208 3 metN Methionine import ATP-binding protein MetN Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W4E1 5.67e-21 97 29 3 206 3 metN Methionine import ATP-binding protein MetN Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7W4E1 4.28e-08 58 24 6 208 3 metN Methionine import ATP-binding protein MetN Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFU9 5.67e-21 97 29 3 206 3 metN Methionine import ATP-binding protein MetN Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7WFU9 4.28e-08 58 24 6 208 3 metN Methionine import ATP-binding protein MetN Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P74548 5.7e-21 97 29 3 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P74548 2.96e-11 68 24 7 218 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P44871 6.27e-21 94 28 4 220 3 ftsE Cell division ATP-binding protein FtsE Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44871 1.51e-06 52 24 6 207 3 ftsE Cell division ATP-binding protein FtsE Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q1B677 6.42e-21 97 28 6 288 3 metN Methionine import ATP-binding protein MetN Mycobacterium sp. (strain MCS)
Q1B677 8.15e-13 73 29 6 215 3 metN Methionine import ATP-binding protein MetN Mycobacterium sp. (strain MCS)
Q578K3 6.46e-21 97 29 4 212 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus biovar 1 (strain 9-941)
Q578K3 1.62e-10 66 27 7 207 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus biovar 1 (strain 9-941)
Q2YKX3 6.46e-21 97 29 4 212 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus (strain 2308)
Q2YKX3 1.62e-10 66 27 7 207 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus (strain 2308)
O86311 6.63e-21 96 32 6 217 1 Rv1218c Multidrug efflux system ATP-binding protein Rv1218c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
O86311 1.96e-08 59 24 7 237 1 Rv1218c Multidrug efflux system ATP-binding protein Rv1218c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P07821 6.69e-21 95 27 4 238 1 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Escherichia coli (strain K12)
P07821 1.38e-11 68 24 6 207 1 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Escherichia coli (strain K12)
Q6F9P2 6.85e-21 97 27 6 253 3 metN2 Methionine import ATP-binding protein MetN 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q6F9P2 6.05e-13 73 25 5 219 3 metN2 Methionine import ATP-binding protein MetN 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q2SY12 7.41e-21 97 27 7 273 3 metN Methionine import ATP-binding protein MetN Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2SY12 7.73e-16 82 30 6 214 3 metN Methionine import ATP-binding protein MetN Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q668L6 7.61e-21 99 29 4 228 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q668L6 4.92e-11 68 24 5 222 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q7NQN5 7.71e-21 97 29 3 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7NQN5 5.81e-19 92 28 5 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q83P97 7.82e-21 95 27 7 235 3 phnC Phosphonates import ATP-binding protein PhnC Shigella flexneri
Q83P97 2.35e-11 67 25 10 236 3 phnC Phosphonates import ATP-binding protein PhnC Shigella flexneri
Q0SXV5 7.82e-21 95 27 7 235 3 phnC Phosphonates import ATP-binding protein PhnC Shigella flexneri serotype 5b (strain 8401)
Q0SXV5 2.35e-11 67 25 10 236 3 phnC Phosphonates import ATP-binding protein PhnC Shigella flexneri serotype 5b (strain 8401)
Q7CJG3 7.88e-21 99 29 4 228 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis
Q7CJG3 5.28e-11 68 24 5 222 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis
Q1C5W7 7.88e-21 99 29 4 228 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C5W7 5.28e-11 68 24 5 222 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis bv. Antiqua (strain Antiqua)
Q1CJW8 7.88e-21 99 29 4 228 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CJW8 5.28e-11 68 24 5 222 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Yersinia pestis bv. Antiqua (strain Nepal516)
Q3A9G5 8.06e-21 97 29 5 228 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q3A9G5 5.46e-17 85 28 7 246 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q9HT70 8.78e-21 96 28 3 215 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9HT70 2.34e-09 62 25 6 211 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DK6 8.78e-21 96 28 3 215 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q02DK6 2.34e-09 62 25 6 211 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
P72335 9.03e-21 96 29 4 228 3 nodI Nod factor export ATP-binding protein I Rhizobium sp. (strain N33)
P72335 5.31e-16 82 29 5 228 3 nodI Nod factor export ATP-binding protein I Rhizobium sp. (strain N33)
Q67SV5 9.43e-21 96 29 5 234 3 metN Methionine import ATP-binding protein MetN Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q67SV5 2.62e-10 65 26 6 211 3 metN Methionine import ATP-binding protein MetN Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q28VL7 9.77e-21 94 29 4 206 3 thiQ Thiamine import ATP-binding protein ThiQ Jannaschia sp. (strain CCS1)
Q28VL7 1.98e-11 67 26 8 214 3 thiQ Thiamine import ATP-binding protein ThiQ Jannaschia sp. (strain CCS1)
Q5PCG9 9.97e-21 96 29 3 206 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PCG9 4.59e-14 77 27 6 216 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8U4K3 1.01e-20 96 29 5 216 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q8U4K3 1.11e-17 87 27 6 219 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q88F88 1.02e-20 99 31 4 233 1 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88F88 3e-09 63 27 9 225 1 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8UKE4 1.03e-20 99 30 5 236 3 macB Macrolide export ATP-binding/permease protein MacB Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8UKE4 2.28e-09 63 27 8 211 3 macB Macrolide export ATP-binding/permease protein MacB Agrobacterium fabrum (strain C58 / ATCC 33970)
P21410 1.05e-20 96 30 6 244 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Serratia marcescens
P21410 7.42e-10 63 26 6 197 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Serratia marcescens
Q31TP8 1.11e-20 95 27 6 230 3 phnC Phosphonates import ATP-binding protein PhnC Shigella boydii serotype 4 (strain Sb227)
Q31TP8 9.5e-12 68 22 8 244 3 phnC Phosphonates import ATP-binding protein PhnC Shigella boydii serotype 4 (strain Sb227)
Q9K789 1.13e-20 96 29 4 229 3 metN Methionine import ATP-binding protein MetN Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9K789 6.53e-13 73 28 7 215 3 metN Methionine import ATP-binding protein MetN Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q03Z27 1.15e-20 97 29 7 239 3 metN Methionine import ATP-binding protein MetN Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q03Z27 1.02e-18 91 30 5 210 3 metN Methionine import ATP-binding protein MetN Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q3JSQ0 1.2e-20 95 27 3 218 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain 1710b)
Q3JSQ0 5.82e-17 85 28 6 245 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain 1710b)
Q62K72 1.2e-20 95 27 3 218 3 nodI Nod factor export ATP-binding protein I Burkholderia mallei (strain ATCC 23344)
Q62K72 5.82e-17 85 28 6 245 3 nodI Nod factor export ATP-binding protein I Burkholderia mallei (strain ATCC 23344)
Q2IN45 1.21e-20 98 28 3 245 3 phnC Phosphonates import ATP-binding protein PhnC Anaeromyxobacter dehalogenans (strain 2CP-C)
Q2IN45 1.3e-05 51 20 5 217 3 phnC Phosphonates import ATP-binding protein PhnC Anaeromyxobacter dehalogenans (strain 2CP-C)
Q8XDV7 1.24e-20 94 27 6 230 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O157:H7
Q8XDV7 2.41e-11 67 22 8 243 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O157:H7
Q87AL9 1.31e-20 96 32 5 208 3 metN Methionine import ATP-binding protein MetN Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q87AL9 2.6e-12 71 26 4 204 3 metN Methionine import ATP-binding protein MetN Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q81VM2 1.42e-20 96 29 4 232 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus anthracis
Q81VM2 3.27e-13 74 30 7 213 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus anthracis
Q63TX3 1.44e-20 95 27 3 218 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain K96243)
Q63TX3 7.09e-17 84 28 6 245 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain K96243)
Q4K9A4 1.46e-20 98 30 6 240 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4K9A4 3.84e-09 62 26 10 222 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q03P57 1.52e-20 96 30 5 245 3 metN Methionine import ATP-binding protein MetN Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q03P57 1.56e-17 87 29 4 207 3 metN Methionine import ATP-binding protein MetN Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS17735
Feature type CDS
Gene rbsA
Product ribose ABC transporter ATP-binding protein RbsA
Location 188457 - 189962 (strand: 1)
Length 1506 (nucleotides) / 501 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000007
Length 196482 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_11
Orthogroup size 19
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1129 Carbohydrate transport and metabolism (G) G ABC-type sugar transport system, ATPase component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K10441 ribose transport system ATP-binding protein [EC:7.5.2.7] ABC transporters -

Protein Sequence

MEPLLELKGIDKAFPGVKALSGAALRVYPGKVMALVGENGAGKSTMMKVLTGIYKKDAGQVLFLGQECQFTGPKSSQEAGIGIIHQELNLIPELTIAENIFLGREFTRAFGAIDWKKMYAEADKLLARLNLRYSSHRLVADLSIGDQQMVEIAKVLSFESKVIIMDEPTDALTDTETESLFSVIRELREQGCGIVYISHRLKEIFEICDDVTVFRDGQFIGEKPVSELTEDTLIEMMVGRKLEEQYPRLNLPRGKEKLVVKNLSGHDVHDVSFTLHENEILGISGLMGAGRTELMKIIYGALPKTGGTVTLDGKTCQISSPKAGLDNGIVYISEDRKRDGLVLGMSVKENMSLTALPYFSSKTGRLNHKEEHLTVGDFIQLFNIKTPGMDQTIGFLSGGNQQKVAIARGLMTRPKVLILDEPTRGVDVGAKKEIYQLINKFKEEGLSIILISSEMPEVMGMSDRILVMHEGRISGEFAADQVSQEALMAAAVGKQYGAGQE

Flanking regions ( +/- flanking 50bp)

GCCGTTCGCCAATGTAATGTTGTTCTCCGGCGTCACGTTCTGAGGTGGCTATGGAACCGTTACTTGAACTGAAAGGCATTGATAAAGCATTCCCGGGTGTGAAAGCTTTATCGGGTGCCGCTTTACGGGTGTATCCCGGTAAAGTGATGGCGCTGGTCGGGGAAAACGGTGCCGGAAAATCCACCATGATGAAAGTGCTGACCGGGATCTATAAAAAAGACGCCGGTCAGGTTCTGTTTCTGGGACAAGAGTGCCAGTTTACGGGACCAAAATCGTCTCAGGAAGCCGGGATCGGGATTATCCATCAGGAACTGAACCTTATTCCTGAGCTGACGATCGCTGAAAATATTTTTCTGGGACGCGAGTTCACCCGGGCATTCGGCGCGATTGACTGGAAAAAAATGTATGCTGAAGCCGATAAATTGCTGGCTCGTCTGAATCTGCGCTACAGCAGCCACCGGCTGGTGGCCGATCTCTCTATCGGTGATCAGCAGATGGTTGAGATTGCCAAAGTGCTCAGTTTTGAGTCAAAAGTCATCATTATGGATGAACCGACGGACGCGCTGACTGACACTGAAACCGAATCCCTCTTCAGCGTTATCCGTGAACTGCGTGAGCAGGGCTGCGGCATTGTGTATATCTCCCACCGCCTGAAAGAAATTTTTGAAATTTGCGATGATGTGACGGTTTTCCGTGACGGGCAGTTTATCGGGGAAAAACCGGTTTCTGAACTGACAGAAGATACCCTGATTGAAATGATGGTCGGGCGCAAACTGGAAGAGCAGTATCCGCGCCTGAATTTACCTCGCGGCAAAGAGAAGCTGGTGGTGAAGAATCTGAGCGGGCACGATGTGCATGATGTCAGCTTCACATTGCATGAAAATGAGATCCTCGGTATTTCCGGGCTGATGGGCGCCGGGCGCACAGAACTGATGAAAATCATTTACGGTGCATTGCCGAAAACCGGCGGCACCGTGACTCTCGACGGCAAAACCTGTCAGATTTCATCGCCTAAAGCGGGGCTGGATAACGGCATCGTGTATATCTCTGAAGACCGCAAACGTGATGGTCTGGTGCTGGGGATGTCGGTGAAAGAAAATATGTCCCTGACCGCACTGCCGTATTTCAGCAGCAAAACCGGGCGGCTTAATCATAAAGAAGAGCATCTGACGGTTGGTGATTTTATTCAGTTGTTCAATATCAAAACTCCGGGGATGGATCAGACTATTGGCTTCTTATCCGGCGGAAATCAGCAGAAAGTGGCGATTGCCCGCGGATTAATGACCCGGCCGAAAGTCCTTATCCTCGATGAGCCGACGCGCGGTGTGGATGTCGGGGCAAAAAAAGAAATTTATCAGCTGATTAATAAATTTAAAGAAGAAGGACTGAGCATCATTCTTATCTCTTCGGAAATGCCGGAAGTGATGGGTATGAGTGATCGCATCCTTGTTATGCATGAGGGACGGATAAGCGGCGAGTTTGCGGCAGACCAGGTCTCTCAGGAAGCATTAATGGCCGCGGCAGTCGGCAAACAATATGGCGCAGGGCAGGAGTAAGATATGCGTACAGAGTCAACCCCGGCGTCTAAGCGCTGGTTTACCAAAGA