Homologs in group_16

Help

18 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04505 FBDBKF_04505 43.9 Morganella morganii S1 mglA galactose/methyl galactoside ABC transporter ATP-binding protein MglA
FBDBKF_04700 FBDBKF_04700 44.9 Morganella morganii S1 xylG ABC-type sugar transport system, ATPase component
FBDBKF_15410 FBDBKF_15410 100.0 Morganella morganii S1 rbsA ribose ABC transporter ATP-binding protein RbsA
EHELCC_05795 EHELCC_05795 43.9 Morganella morganii S2 mglA galactose/methyl galactoside ABC transporter ATP-binding protein MglA
EHELCC_05990 EHELCC_05990 44.9 Morganella morganii S2 xylG ABC-type sugar transport system, ATPase component
EHELCC_15770 EHELCC_15770 100.0 Morganella morganii S2 rbsA ribose ABC transporter ATP-binding protein RbsA
NLDBIP_06115 NLDBIP_06115 43.9 Morganella morganii S4 mglA galactose/methyl galactoside ABC transporter ATP-binding protein MglA
NLDBIP_06310 NLDBIP_06310 44.9 Morganella morganii S4 xylG ABC-type sugar transport system, ATPase component
NLDBIP_16600 NLDBIP_16600 100.0 Morganella morganii S4 rbsA ribose ABC transporter ATP-binding protein RbsA
LHKJJB_02995 LHKJJB_02995 43.9 Morganella morganii S3 mglA galactose/methyl galactoside ABC transporter ATP-binding protein MglA
LHKJJB_03190 LHKJJB_03190 44.9 Morganella morganii S3 xylG ABC-type sugar transport system, ATPase component
LHKJJB_16205 LHKJJB_16205 100.0 Morganella morganii S3 rbsA ribose ABC transporter ATP-binding protein RbsA
HKOGLL_06470 HKOGLL_06470 43.9 Morganella morganii S5 mglA galactose/methyl galactoside ABC transporter ATP-binding protein MglA
HKOGLL_06665 HKOGLL_06665 44.9 Morganella morganii S5 xylG ABC-type sugar transport system, ATPase component
F4V73_RS09120 F4V73_RS09120 41.2 Morganella psychrotolerans - sugar ABC transporter ATP-binding protein
F4V73_RS09175 F4V73_RS09175 45.9 Morganella psychrotolerans - sugar ABC transporter ATP-binding protein
F4V73_RS17735 F4V73_RS17735 94.6 Morganella psychrotolerans rbsA ribose ABC transporter ATP-binding protein RbsA
PMI_RS00440 PMI_RS00440 84.4 Proteus mirabilis HI4320 rbsA ribose ABC transporter ATP-binding protein RbsA

Distribution of the homologs in the orthogroup group_16

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_16

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q6DB87 0.0 822 80 0 501 3 rbsA Ribose import ATP-binding protein RbsA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7NA79 0.0 814 79 0 501 3 rbsA Ribose import ATP-binding protein RbsA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q1R4I3 0.0 802 79 0 501 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli (strain UTI89 / UPEC)
P04983 0.0 801 79 0 501 1 rbsA Ribose import ATP-binding protein RbsA Escherichia coli (strain K12)
Q0TAW0 0.0 801 79 0 501 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8FBS3 0.0 800 79 0 501 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8XAW7 0.0 798 79 0 501 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Escherichia coli O157:H7
Q3YVK8 0.0 798 79 0 501 3 rbsA Ribose import ATP-binding protein RbsA Shigella sonnei (strain Ss046)
Q8ZKV9 0.0 796 78 0 501 3 rbsA Ribose import ATP-binding protein RbsA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57HW1 0.0 796 78 0 501 3 rbsA Ribose import ATP-binding protein RbsA Salmonella choleraesuis (strain SC-B67)
Q5PJX5 0.0 794 78 0 501 3 rbsA Ribose import ATP-binding protein RbsA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z2R4 0.0 792 78 0 501 3 rbsA Ribose import ATP-binding protein RbsA Salmonella typhi
Q9CP98 0.0 726 73 1 493 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Pasteurella multocida (strain Pm70)
Q9CP98 6.76e-18 89 26 3 230 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Pasteurella multocida (strain Pm70)
Q8D7T7 0.0 723 72 1 494 3 rbsA Ribose import ATP-binding protein RbsA Vibrio vulnificus (strain CMCP6)
Q8D7T7 3.8e-14 78 25 3 221 3 rbsA Ribose import ATP-binding protein RbsA Vibrio vulnificus (strain CMCP6)
Q7MEV1 0.0 723 72 1 494 3 rbsA Ribose import ATP-binding protein RbsA Vibrio vulnificus (strain YJ016)
Q7MEV1 2.89e-14 78 25 3 221 3 rbsA Ribose import ATP-binding protein RbsA Vibrio vulnificus (strain YJ016)
Q87H79 0.0 721 73 1 494 3 rbsA Ribose import ATP-binding protein RbsA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87H79 1.27e-13 76 24 3 221 3 rbsA Ribose import ATP-binding protein RbsA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q4QN44 0.0 718 71 1 494 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain 86-028NP)
Q4QN44 2.93e-21 100 26 3 230 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain 86-028NP)
P44735 0.0 713 71 1 494 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44735 3.42e-21 100 26 3 230 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9KN37 0.0 707 72 1 494 3 rbsA Ribose import ATP-binding protein RbsA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q6LH11 0.0 706 71 1 493 3 rbsA Ribose import ATP-binding protein RbsA Photobacterium profundum (strain SS9)
Q6LH11 5.18e-20 96 26 3 230 3 rbsA Ribose import ATP-binding protein RbsA Photobacterium profundum (strain SS9)
Q6LH11 3.04e-16 84 26 4 237 3 rbsA Ribose import ATP-binding protein RbsA Photobacterium profundum (strain SS9)
Q5E4V6 0.0 705 70 1 493 3 rbsA Ribose import ATP-binding protein RbsA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q5E4V6 5.58e-21 99 27 3 224 3 rbsA Ribose import ATP-binding protein RbsA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q5E4V6 3.36e-14 78 25 5 247 3 rbsA Ribose import ATP-binding protein RbsA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q0TPX5 0.0 520 52 4 497 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0TPX5 1.42e-17 89 25 5 233 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0SSJ0 0.0 520 52 4 497 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain SM101 / Type A)
Q0SSJ0 1.48e-17 89 25 5 233 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain SM101 / Type A)
Q8RD43 0.0 520 51 1 494 3 rbsA Ribose import ATP-binding protein RbsA Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8RD43 2.98e-21 100 29 3 228 3 rbsA Ribose import ATP-binding protein RbsA Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8XJX3 0.0 519 52 4 497 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain 13 / Type A)
Q8XJX3 2.28e-17 88 24 5 233 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain 13 / Type A)
Q891M1 1.26e-177 511 51 2 494 3 rbsA Ribose import ATP-binding protein RbsA Clostridium tetani (strain Massachusetts / E88)
Q891M1 2.34e-18 91 26 3 230 3 rbsA Ribose import ATP-binding protein RbsA Clostridium tetani (strain Massachusetts / E88)
Q8RBQ1 8.09e-163 473 50 2 491 3 TTE0763 Putative ribose/galactose/methyl galactoside import ATP-binding protein Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q5KUX3 3.57e-162 471 48 3 492 3 rbsA Ribose import ATP-binding protein RbsA Geobacillus kaustophilus (strain HTA426)
Q5KUX3 1.34e-22 104 29 4 231 3 rbsA Ribose import ATP-binding protein RbsA Geobacillus kaustophilus (strain HTA426)
Q4KDI2 3.49e-161 470 48 3 494 3 PFL_2594 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4KDI2 1.19e-17 89 26 3 226 3 PFL_2594 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q6HNE7 6.8e-159 463 47 3 491 3 rbsA Ribose import ATP-binding protein RbsA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HNE7 3.57e-21 99 28 5 243 3 rbsA Ribose import ATP-binding protein RbsA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81V36 6.8e-159 463 47 3 491 3 rbsA Ribose import ATP-binding protein RbsA Bacillus anthracis
Q81V36 3.57e-21 99 28 5 243 3 rbsA Ribose import ATP-binding protein RbsA Bacillus anthracis
Q48GY7 9.93e-159 464 48 2 493 3 PSPPH_3184 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q48GY7 1.58e-14 79 24 4 220 3 PSPPH_3184 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q87ZE0 4.45e-158 462 47 2 493 3 PSPTO_3489 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q87ZE0 1.72e-15 82 25 4 220 3 PSPTO_3489 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q5KYS1 4.7e-158 461 49 6 500 3 xylG Xylose import ATP-binding protein XylG Geobacillus kaustophilus (strain HTA426)
Q5KYS1 1.05e-13 77 24 4 241 3 xylG Xylose import ATP-binding protein XylG Geobacillus kaustophilus (strain HTA426)
Q5KYS1 1.06e-13 77 24 4 232 3 xylG Xylose import ATP-binding protein XylG Geobacillus kaustophilus (strain HTA426)
Q63FX9 5.37e-158 461 47 3 491 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ZK / E33L)
Q63FX9 3.11e-21 100 28 5 243 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ZK / E33L)
Q2SMT0 8.7e-158 461 47 1 475 3 HCH_01167 Putative ribose/galactose/methyl galactoside import ATP-binding protein Hahella chejuensis (strain KCTC 2396)
Q2SMT0 5.12e-15 81 26 3 226 3 HCH_01167 Putative ribose/galactose/methyl galactoside import ATP-binding protein Hahella chejuensis (strain KCTC 2396)
Q4ZRC6 1.38e-157 461 48 2 493 3 Psyr_3264 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas syringae pv. syringae (strain B728a)
Q4ZRC6 4.4e-16 84 25 4 220 3 Psyr_3264 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas syringae pv. syringae (strain B728a)
Q81HW8 3.17e-157 459 47 3 491 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81HW8 5.08e-20 96 28 5 243 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q13FD9 4.37e-157 459 47 3 498 3 Bxeno_C1272 Putative ribose/galactose/methyl galactoside import ATP-binding protein Paraburkholderia xenovorans (strain LB400)
Q9X051 4.01e-156 457 48 5 504 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9X051 4.82e-18 90 26 4 230 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q8E7N9 6.57e-156 456 48 1 489 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype III (strain NEM316)
Q8E7N9 5.08e-18 90 28 4 225 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype III (strain NEM316)
Q8E7N9 1.48e-17 89 27 3 225 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype III (strain NEM316)
P36947 8.54e-156 455 47 2 490 3 rbsA Ribose import ATP-binding protein RbsA Bacillus subtilis (strain 168)
Q3K3R2 9.62e-156 455 48 1 489 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q3K3R2 8.41e-18 89 28 4 225 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q3K3R2 9.46e-18 89 27 3 225 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8ENB3 2.86e-155 454 46 3 496 3 rbsA Ribose import ATP-binding protein RbsA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q73DH7 3.75e-155 454 47 3 491 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q73DH7 1.06e-21 101 29 4 231 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q1BX03 6.41e-155 454 46 1 489 3 Bcen_0943 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia orbicola (strain AU 1054)
Q1BX03 2.09e-17 88 26 4 226 3 Bcen_0943 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia orbicola (strain AU 1054)
A0K6Q0 6.41e-155 454 46 1 489 3 Bcen2424_1425 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia cenocepacia (strain HI2424)
A0K6Q0 2.09e-17 88 26 4 226 3 Bcen2424_1425 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia cenocepacia (strain HI2424)
Q8E281 7.43e-155 453 47 1 489 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E281 9.72e-18 89 28 4 225 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E281 2.96e-17 87 27 3 225 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q6VMN4 9.52e-155 453 47 6 505 3 xylG Xylose import ATP-binding protein XylG Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q6VMN4 1.23e-17 89 26 4 237 3 xylG Xylose import ATP-binding protein XylG Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q6VMN4 6.76e-16 84 28 5 241 3 xylG Xylose import ATP-binding protein XylG Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q2K353 1.08e-154 453 47 1 491 3 RHE_CH03989 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2K353 4.17e-21 99 28 4 227 3 RHE_CH03989 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q0BG60 3.49e-154 452 46 2 490 3 Bamb_1305 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q0BG60 1.01e-15 83 25 4 226 3 Bamb_1305 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q3JHZ1 4.15e-154 452 45 6 503 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia pseudomallei (strain 1710b)
Q6LK34 7.73e-154 450 47 3 491 3 mglA1 Galactose/methyl galactoside import ATP-binding protein MglA 1 Photobacterium profundum (strain SS9)
Q6LK34 4.95e-17 87 25 4 232 3 mglA1 Galactose/methyl galactoside import ATP-binding protein MglA 1 Photobacterium profundum (strain SS9)
Q65E55 1.39e-153 449 47 2 490 3 rbsA Ribose import ATP-binding protein RbsA Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q63P06 1.5e-153 450 45 6 503 3 rbsA Ribose import ATP-binding protein RbsA Burkholderia pseudomallei (strain K96243)
Q1BWN5 1.6e-153 450 45 6 503 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia orbicola (strain AU 1054)
A0K718 1.6e-153 450 45 6 503 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia cenocepacia (strain HI2424)
Q2T8T6 1.78e-153 450 45 6 504 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q8UBN2 1.79e-153 450 46 4 496 3 Atu2819 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q0BFU0 2.31e-153 450 45 6 506 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q8UAK2 2.44e-153 450 46 1 491 3 Atu3371 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8UAK2 8.88e-20 95 26 3 226 3 Atu3371 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q39HA1 2.5e-153 450 46 2 490 3 Bcep18194_A4569 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q39HA1 4.67e-17 87 26 4 226 3 Bcep18194_A4569 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1MAA2 1.27e-152 448 46 1 491 3 RL4654 Putative ribose/galactose/methyl galactoside import ATP-binding protein Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1MAA2 2.52e-22 103 29 4 227 3 RL4654 Putative ribose/galactose/methyl galactoside import ATP-binding protein Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q0B775 1.37e-152 448 46 4 497 3 Bamb_4447 Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q39GY8 2.64e-152 447 45 6 506 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1BQ82 1.82e-151 445 45 3 497 3 Bcen_3328 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia orbicola (strain AU 1054)
A0B297 1.82e-151 445 45 3 497 3 Bcen2424_5039 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia cenocepacia (strain HI2424)
Q92S10 3.41e-151 444 44 2 494 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rhizobium meliloti (strain 1021)
Q92S10 5e-16 84 27 5 243 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rhizobium meliloti (strain 1021)
Q399X3 6.57e-151 443 45 4 498 3 Bcep18194_B0624 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q9KAG5 1.1e-150 443 46 3 493 3 BH2322 Putative ribose/galactose/methyl galactoside import ATP-binding protein Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KAG5 4.09e-18 90 28 3 225 3 BH2322 Putative ribose/galactose/methyl galactoside import ATP-binding protein Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8Y003 1.38e-150 443 45 1 489 3 RSc1242 Putative ribose/galactose/methyl galactoside import ATP-binding protein Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8Y003 2.41e-16 85 26 4 227 3 RSc1242 Putative ribose/galactose/methyl galactoside import ATP-binding protein Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2KAW9 1.69e-150 443 47 4 498 3 RHE_CH01212 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2KAW9 1.19e-11 70 27 5 215 3 RHE_CH01212 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q5KYQ7 1.9e-150 442 46 3 493 3 GK1894 Putative ribose/galactose/methyl galactoside import ATP-binding protein Geobacillus kaustophilus (strain HTA426)
Q5KYQ7 1.77e-17 88 28 4 227 3 GK1894 Putative ribose/galactose/methyl galactoside import ATP-binding protein Geobacillus kaustophilus (strain HTA426)
Q5KYQ7 3.23e-14 78 23 5 230 3 GK1894 Putative ribose/galactose/methyl galactoside import ATP-binding protein Geobacillus kaustophilus (strain HTA426)
Q9RDI1 2.47e-150 442 47 5 498 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8X5D9 3.69e-150 441 45 3 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O157:H7
Q8X5D9 2.22e-16 85 26 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O157:H7
Q66C83 3.94e-150 441 45 4 492 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q66C83 6.74e-14 77 23 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CGT1 3.94e-150 441 45 4 492 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CGT1 6.74e-14 77 23 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CHQ3 3.94e-150 441 45 4 492 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pestis
Q7CHQ3 6.74e-14 77 23 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pestis
Q1C9V1 3.94e-150 441 45 4 492 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C9V1 6.74e-14 77 23 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Yersinia pestis bv. Antiqua (strain Antiqua)
Q825P1 8.52e-150 440 44 2 487 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q82CM5 1.21e-149 441 47 6 496 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8FFU7 1.26e-149 440 45 3 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FFU7 2.16e-16 85 26 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFU2 1.26e-149 440 45 3 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TFU2 2.16e-16 85 26 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q3Z057 1.45e-149 440 45 3 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella sonnei (strain Ss046)
Q3Z057 2.36e-16 85 26 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella sonnei (strain Ss046)
P0AAG9 1.45e-149 440 45 3 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella flexneri
P0AAG9 2.36e-16 85 26 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella flexneri
P0AAG8 1.45e-149 440 45 3 494 1 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli (strain K12)
P0AAG8 2.36e-16 85 26 3 225 1 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli (strain K12)
Q0T2X5 2.17e-149 439 44 3 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella flexneri serotype 5b (strain 8401)
Q0T2X5 2.66e-16 85 26 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella flexneri serotype 5b (strain 8401)
Q1R9S4 2.17e-149 439 45 3 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli (strain UTI89 / UPEC)
Q1R9S4 4.94e-17 87 26 3 226 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli (strain UTI89 / UPEC)
Q8CK44 2.88e-149 439 44 2 487 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q5WC31 3.61e-149 439 45 3 492 3 rbsA Ribose import ATP-binding protein RbsA Shouchella clausii (strain KSM-K16)
Q5WC31 1.78e-20 97 30 6 241 3 rbsA Ribose import ATP-binding protein RbsA Shouchella clausii (strain KSM-K16)
Q8FCE2 4.54e-149 439 44 4 507 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FCE2 1.12e-11 70 26 5 236 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBN5 4.54e-149 439 44 4 507 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TBN5 1.12e-11 70 26 5 236 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q2NUD6 5.46e-149 438 44 5 495 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Sodalis glossinidius (strain morsitans)
Q2NUD6 3.93e-15 81 24 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Sodalis glossinidius (strain morsitans)
Q1R528 8.91e-149 438 44 4 507 3 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain UTI89 / UPEC)
Q1R528 1.31e-11 70 26 5 236 3 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain UTI89 / UPEC)
Q663Y5 1.38e-148 437 44 4 503 3 xylG Xylose import ATP-binding protein XylG Yersinia pseudotuberculosis serotype I (strain IP32953)
Q663Y5 9.25e-15 80 26 6 239 3 xylG Xylose import ATP-binding protein XylG Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CDC0 1.38e-148 437 44 4 503 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CDC0 9.25e-15 80 26 6 239 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CFR2 1.38e-148 437 44 4 503 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis
Q7CFR2 9.25e-15 80 26 6 239 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis
Q1C0D5 1.38e-148 437 44 4 503 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C0D5 9.25e-15 80 26 6 239 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Antiqua)
Q92TS8 1.58e-148 437 45 1 491 3 RB1420 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Rhizobium meliloti (strain 1021)
Q92TS8 3.05e-18 90 27 4 227 3 RB1420 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Rhizobium meliloti (strain 1021)
Q1AXG5 1.69e-148 437 45 7 506 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q31V51 1.91e-148 437 44 4 507 3 xylG Xylose import ATP-binding protein XylG Shigella boydii serotype 4 (strain Sb227)
Q31V51 1.38e-11 70 26 5 236 3 xylG Xylose import ATP-binding protein XylG Shigella boydii serotype 4 (strain Sb227)
Q8XDM1 1.91e-148 437 44 4 507 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O157:H7
Q8XDM1 1.38e-11 70 26 5 236 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O157:H7
P37388 2.88e-148 437 44 4 507 1 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain K12)
P37388 5.03e-11 68 25 5 236 1 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain K12)
Q31YV7 2.91e-148 436 44 3 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella boydii serotype 4 (strain Sb227)
Q31YV7 1.37e-16 85 26 3 225 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella boydii serotype 4 (strain Sb227)
Q8U9B0 3.73e-148 436 45 3 492 3 Atu3818 Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q6LUY1 3.78e-148 436 45 5 509 3 xylG Xylose import ATP-binding protein XylG Photobacterium profundum (strain SS9)
Q9K6J9 4.25e-148 436 44 3 492 3 rbsA Ribose import ATP-binding protein RbsA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9K6J9 6.58e-21 99 28 4 238 3 rbsA Ribose import ATP-binding protein RbsA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q0SY86 7.49e-148 436 44 4 507 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri serotype 5b (strain 8401)
Q0SY86 1.91e-11 69 26 5 236 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri serotype 5b (strain 8401)
Q8X5Q4 8.62e-148 435 45 4 493 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Escherichia coli O157:H7
Q8X5Q4 3.48e-24 108 31 3 224 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Escherichia coli O157:H7
Q28P50 1.16e-147 435 43 2 493 3 rbsA Ribose import ATP-binding protein RbsA Jannaschia sp. (strain CCS1)
Q28P50 9.49e-15 80 26 5 244 3 rbsA Ribose import ATP-binding protein RbsA Jannaschia sp. (strain CCS1)
Q2RGX2 1.93e-147 434 45 5 501 3 xylG Xylose import ATP-binding protein XylG Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q2RGX2 1.86e-13 76 25 5 228 3 xylG Xylose import ATP-binding protein XylG Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q2RGX2 7.9e-12 71 25 3 232 3 xylG Xylose import ATP-binding protein XylG Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q1BGC0 2.64e-147 434 46 3 496 3 Bcen_6474 Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 Burkholderia orbicola (strain AU 1054)
A0KE25 2.64e-147 434 46 3 496 3 Bcen2424_6709 Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 Burkholderia cenocepacia (strain HI2424)
Q1CDJ0 3.62e-147 434 45 4 493 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CDJ0 1.4e-23 107 31 3 224 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CG00 3.62e-147 434 45 4 493 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis
Q7CG00 1.4e-23 107 31 3 224 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis
Q1C1B8 3.62e-147 434 45 4 493 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C1B8 1.4e-23 107 31 3 224 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Antiqua)
Q664G2 4.26e-147 434 45 4 493 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q664G2 1.43e-23 107 31 3 224 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q3MB44 5.71e-147 434 46 7 498 3 rbsA Ribose import ATP-binding protein RbsA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q3MB44 6.91e-22 102 28 3 227 3 rbsA Ribose import ATP-binding protein RbsA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q83J33 5.71e-147 433 44 4 507 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri
Q83J33 1.9e-10 66 25 5 236 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri
Q2K0S7 7.82e-147 433 43 2 492 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q7NTN6 1.17e-146 432 46 4 489 3 rbsA Ribose import ATP-binding protein RbsA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7NTN6 1.82e-15 82 28 2 230 3 rbsA Ribose import ATP-binding protein RbsA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q02XM9 1.34e-146 432 45 1 489 3 rbsA Ribose import ATP-binding protein RbsA Lactococcus lactis subsp. cremoris (strain SK11)
Q02XM9 2.32e-18 91 28 4 224 3 rbsA Ribose import ATP-binding protein RbsA Lactococcus lactis subsp. cremoris (strain SK11)
Q02XM9 9.41e-15 80 26 3 224 3 rbsA Ribose import ATP-binding protein RbsA Lactococcus lactis subsp. cremoris (strain SK11)
Q6DB03 1.8e-146 432 43 4 509 3 xylG Xylose import ATP-binding protein XylG Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6LG59 2.58e-146 431 44 2 493 3 mglA2 Galactose/methyl galactoside import ATP-binding protein MglA 2 Photobacterium profundum (strain SS9)
Q6LG59 9.13e-13 73 23 4 226 3 mglA2 Galactose/methyl galactoside import ATP-binding protein MglA 2 Photobacterium profundum (strain SS9)
P23924 2.97e-146 431 43 3 494 1 mglA Galactose/methyl galactoside import ATP-binding protein MglA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P23924 2.63e-16 85 25 3 225 1 mglA Galactose/methyl galactoside import ATP-binding protein MglA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q1M5X4 1.69e-145 430 43 2 492 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q9CF44 3e-145 428 45 4 495 3 rbsA Ribose import ATP-binding protein RbsA Lactococcus lactis subsp. lactis (strain IL1403)
Q03CA4 4.49e-144 426 46 2 490 3 rbsA Ribose import ATP-binding protein RbsA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q03CA4 2.67e-24 109 30 3 232 3 rbsA Ribose import ATP-binding protein RbsA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q0BGD7 4.99e-144 426 45 5 498 3 Bamb_1228 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q1BG93 7.06e-144 426 45 5 503 3 xylG Xylose import ATP-binding protein XylG Burkholderia orbicola (strain AU 1054)
Q1BG93 1.73e-14 79 27 7 255 3 xylG Xylose import ATP-binding protein XylG Burkholderia orbicola (strain AU 1054)
A0KE53 7.06e-144 426 45 5 503 3 xylG Xylose import ATP-binding protein XylG Burkholderia cenocepacia (strain HI2424)
A0KE53 1.73e-14 79 27 7 255 3 xylG Xylose import ATP-binding protein XylG Burkholderia cenocepacia (strain HI2424)
Q21TR5 1.09e-143 425 46 5 500 3 Rfer_3129 Putative ribose/galactose/methyl galactoside import ATP-binding protein Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q1AVD3 2.93e-143 424 45 4 494 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q1AVD3 1.63e-15 82 26 4 231 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q13RB6 8.29e-143 423 44 5 503 3 xylG Xylose import ATP-binding protein XylG Paraburkholderia xenovorans (strain LB400)
Q13RB6 1.1e-14 80 26 5 253 3 xylG Xylose import ATP-binding protein XylG Paraburkholderia xenovorans (strain LB400)
Q7UU57 1.13e-142 422 44 6 501 3 rbsA Ribose import ATP-binding protein RbsA Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q9KSD1 4.33e-142 421 42 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9KSD1 3.22e-11 69 22 4 226 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q1ARR5 4.53e-142 420 43 3 494 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q1ARR5 8.53e-22 101 29 4 244 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q1ARR5 6.03e-16 84 24 3 230 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q164K3 5.26e-142 421 43 2 492 3 rbsA Ribose import ATP-binding protein RbsA Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q164K3 4.51e-15 81 26 5 238 3 rbsA Ribose import ATP-binding protein RbsA Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q576H3 5.43e-142 421 46 6 505 3 xylG Xylose import ATP-binding protein XylG Brucella abortus biovar 1 (strain 9-941)
Q576H3 2.53e-14 79 26 4 244 3 xylG Xylose import ATP-binding protein XylG Brucella abortus biovar 1 (strain 9-941)
Q2YJE7 5.43e-142 421 46 6 505 3 xylG Xylose import ATP-binding protein XylG Brucella abortus (strain 2308)
Q2YJE7 2.53e-14 79 26 4 244 3 xylG Xylose import ATP-binding protein XylG Brucella abortus (strain 2308)
Q8XKQ2 5.92e-142 421 43 2 487 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain 13 / Type A)
Q8XKQ2 5.27e-18 90 24 3 226 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain 13 / Type A)
Q8XKQ2 1.29e-11 70 22 4 239 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain 13 / Type A)
Q329G7 1.26e-141 419 44 5 494 3 rbsA Ribose import ATP-binding protein RbsA Shigella dysenteriae serotype 1 (strain Sd197)
Q329G7 4.13e-23 105 31 3 224 3 rbsA Ribose import ATP-binding protein RbsA Shigella dysenteriae serotype 1 (strain Sd197)
Q9CM08 1.46e-141 419 42 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Pasteurella multocida (strain Pm70)
Q9CM08 6.86e-18 90 24 4 243 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Pasteurella multocida (strain Pm70)
Q7MG07 2.36e-141 419 42 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio vulnificus (strain YJ016)
Q7MG07 2.29e-13 75 23 4 226 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio vulnificus (strain YJ016)
Q65UW1 2.8e-141 419 43 5 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q65UW1 5.61e-15 80 24 3 224 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q0TQU8 4.22e-141 419 43 2 487 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0TQU8 5.13e-18 90 24 3 226 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0TQU8 7.67e-12 71 22 5 257 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8YDN0 4.36e-141 418 46 6 505 3 xylG Xylose import ATP-binding protein XylG Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8YDN0 4.79e-14 78 26 4 244 3 xylG Xylose import ATP-binding protein XylG Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8D4H4 6.46e-141 417 42 2 493 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio vulnificus (strain CMCP6)
Q8D4H4 2.19e-13 75 23 4 226 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio vulnificus (strain CMCP6)
Q0ST95 8.26e-141 418 43 2 487 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain SM101 / Type A)
Q0ST95 2.78e-18 91 24 3 230 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain SM101 / Type A)
Q0ST95 1.94e-11 69 22 4 257 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain SM101 / Type A)
Q1BJW2 8.35e-141 418 45 3 494 3 araG2 Arabinose import ATP-binding protein AraG 2 Burkholderia orbicola (strain AU 1054)
A0B3Z7 8.35e-141 418 45 3 494 3 araG2 Arabinose import ATP-binding protein AraG 2 Burkholderia cenocepacia (strain HI2424)
Q1J3P2 1.13e-140 417 42 3 497 3 rbsA Ribose import ATP-binding protein RbsA Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q8UA86 1.28e-140 417 42 2 493 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q13LX0 4.3e-140 416 42 2 496 3 rbsA Ribose import ATP-binding protein RbsA Paraburkholderia xenovorans (strain LB400)
Q8FUR8 7.41e-140 415 45 6 505 3 xylG Xylose import ATP-binding protein XylG Brucella suis biovar 1 (strain 1330)
Q8FUR8 7.08e-13 74 26 4 244 3 xylG Xylose import ATP-binding protein XylG Brucella suis biovar 1 (strain 1330)
Q1JUP7 2.02e-139 414 45 3 494 3 araG Arabinose import ATP-binding protein AraG Azospirillum brasilense
Q8XPK6 4.19e-139 413 44 5 501 3 xylG Xylose import ATP-binding protein XylG Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8XPK6 2.42e-13 75 25 4 240 3 xylG Xylose import ATP-binding protein XylG Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q896Y2 4.75e-139 413 44 2 494 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium tetani (strain Massachusetts / E88)
Q896Y2 3.43e-18 90 27 4 236 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium tetani (strain Massachusetts / E88)
Q9K7C3 5.86e-139 413 46 6 499 3 araG L-arabinose transport ATP-binding protein AraG Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9K7C3 2.92e-10 66 25 5 234 3 araG L-arabinose transport ATP-binding protein AraG Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q0S9A4 6.03e-139 412 43 3 500 3 rbsA Ribose import ATP-binding protein RbsA Rhodococcus jostii (strain RHA1)
P44884 1.01e-138 412 42 3 492 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44884 1.07e-16 86 24 4 243 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QM77 1.01e-138 412 42 3 492 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Haemophilus influenzae (strain 86-028NP)
Q4QM77 1.07e-16 86 24 4 243 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Haemophilus influenzae (strain 86-028NP)
Q39BJ8 1.08e-138 412 45 3 494 3 araG2 Arabinose import ATP-binding protein AraG 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q65WJ1 2.55e-138 411 44 3 499 3 araG Arabinose import ATP-binding protein AraG Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q0B1U4 3.04e-138 411 43 5 503 3 xylG Xylose import ATP-binding protein XylG Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q0B1U4 9.65e-15 80 26 4 230 3 xylG Xylose import ATP-binding protein XylG Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q8NR12 3.2e-138 411 44 5 494 3 rbsA Ribose import ATP-binding protein RbsA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q2SJ99 9.69e-138 409 43 2 497 3 rbsA Ribose import ATP-binding protein RbsA Hahella chejuensis (strain KCTC 2396)
Q2SJ99 7e-17 86 26 3 230 3 rbsA Ribose import ATP-binding protein RbsA Hahella chejuensis (strain KCTC 2396)
Q8REE1 1.06e-137 409 43 3 489 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8REE1 1.42e-16 85 26 5 230 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8REE1 1.51e-09 63 19 3 224 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q1GHE5 1.52e-137 409 41 3 500 3 rbsA Ribose import ATP-binding protein RbsA Ruegeria sp. (strain TM1040)
Q1M360 2.7e-137 409 42 3 495 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1M360 1.97e-19 94 29 5 231 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q9CL63 1.24e-136 407 42 3 494 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Pasteurella multocida (strain Pm70)
Q1MBG4 1.49e-136 406 43 5 502 3 araG Arabinose import ATP-binding protein AraG Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2SW38 3.55e-136 406 43 5 503 3 xylG Xylose import ATP-binding protein XylG Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2SW38 1.06e-14 80 27 7 255 3 xylG Xylose import ATP-binding protein XylG Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q0B5V4 3.96e-136 406 44 3 493 3 araG2 Arabinose import ATP-binding protein AraG 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q87FK7 4.3e-136 405 43 4 498 3 araG Arabinose import ATP-binding protein AraG Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q92W60 3.05e-135 403 41 4 499 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium meliloti (strain 1021)
Q92W60 1.11e-17 89 28 4 226 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium meliloti (strain 1021)
Q4ZTW1 1.8e-133 399 43 3 495 3 araG Arabinose import ATP-binding protein AraG Pseudomonas syringae pv. syringae (strain B728a)
Q2K3Y7 3.14e-133 398 42 5 499 3 araG Arabinose import ATP-binding protein AraG Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q0I348 8.88e-133 397 42 4 503 3 xylG Xylose import ATP-binding protein XylG Histophilus somni (strain 129Pt)
Q0I348 3.21e-12 72 26 4 230 3 xylG Xylose import ATP-binding protein XylG Histophilus somni (strain 129Pt)
Q398W2 1.14e-132 397 41 2 506 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q6D4W8 1.16e-132 397 42 3 492 3 araG Arabinose import ATP-binding protein AraG Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D4W8 2.97e-20 97 31 6 241 3 araG Arabinose import ATP-binding protein AraG Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q48IS7 1.27e-132 397 43 3 492 3 araG Arabinose import ATP-binding protein AraG Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q987E7 1.31e-132 397 42 4 493 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q987E7 6.09e-15 80 23 4 234 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q92W56 1.4e-132 396 42 5 495 3 araG Arabinose import ATP-binding protein AraG Rhizobium meliloti (strain 1021)
Q9WXX0 1.73e-132 397 43 6 509 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q2K204 3.36e-132 395 43 4 496 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2K204 9.66e-21 98 29 4 231 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q13U53 1.5e-131 394 42 5 502 3 araG Arabinose import ATP-binding protein AraG Paraburkholderia xenovorans (strain LB400)
P45046 6.08e-131 392 42 4 500 3 xylG Xylose import ATP-binding protein XylG Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45046 1.68e-13 76 27 4 230 3 xylG Xylose import ATP-binding protein XylG Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q3KDW2 7.28e-131 392 42 6 505 3 xylG Xylose import ATP-binding protein XylG Pseudomonas fluorescens (strain Pf0-1)
Q3KDW2 9.21e-13 73 26 6 245 3 xylG Xylose import ATP-binding protein XylG Pseudomonas fluorescens (strain Pf0-1)
Q0B7X0 1.04e-130 392 41 2 505 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q2T4S8 3.4e-130 391 43 3 492 3 araG2 Arabinose import ATP-binding protein AraG 2 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q880Z2 6.07e-130 390 42 5 501 3 xylG Xylose import ATP-binding protein XylG Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q880Z2 2.65e-11 69 25 7 248 3 xylG Xylose import ATP-binding protein XylG Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q882I8 2.11e-129 388 42 3 495 3 araG Arabinose import ATP-binding protein AraG Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q73KK2 2.8e-129 388 40 3 488 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73KK2 3.25e-16 84 24 5 227 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73KK2 7.97e-08 58 22 5 253 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q4ZSF3 5.91e-129 387 42 6 503 3 xylG Xylose import ATP-binding protein XylG Pseudomonas syringae pv. syringae (strain B728a)
Q4ZSF3 3.14e-12 72 26 8 251 3 xylG Xylose import ATP-binding protein XylG Pseudomonas syringae pv. syringae (strain B728a)
Q66AF5 7.05e-129 387 42 4 494 3 araG Arabinose import ATP-binding protein AraG Yersinia pseudotuberculosis serotype I (strain IP32953)
Q66AF5 1.11e-17 89 30 6 240 3 araG Arabinose import ATP-binding protein AraG Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CIX6 7.05e-129 387 42 4 494 3 araG Arabinose import ATP-binding protein AraG Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CIX6 1.11e-17 89 30 6 240 3 araG Arabinose import ATP-binding protein AraG Yersinia pestis bv. Antiqua (strain Nepal516)
Q0WER5 7.05e-129 387 42 4 494 3 araG Arabinose import ATP-binding protein AraG Yersinia pestis
Q0WER5 1.11e-17 89 30 6 240 3 araG Arabinose import ATP-binding protein AraG Yersinia pestis
Q1C7J0 7.05e-129 387 42 4 494 3 araG Arabinose import ATP-binding protein AraG Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C7J0 1.11e-17 89 30 6 240 3 araG Arabinose import ATP-binding protein AraG Yersinia pestis bv. Antiqua (strain Antiqua)
Q9S472 1.54e-128 386 44 7 501 3 araG L-arabinose transport ATP-binding protein AraG Geobacillus stearothermophilus
Q9S472 8.71e-13 73 26 6 236 3 araG L-arabinose transport ATP-binding protein AraG Geobacillus stearothermophilus
Q48J74 1.62e-128 386 42 5 501 3 xylG Xylose import ATP-binding protein XylG Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q48J74 1.41e-10 67 25 7 248 3 xylG Xylose import ATP-binding protein XylG Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8XVS2 1.14e-127 384 42 5 499 3 araG Arabinose import ATP-binding protein AraG Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8U949 2.79e-127 383 40 2 494 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q3K8M7 3.44e-127 383 42 3 497 3 araG Arabinose import ATP-binding protein AraG Pseudomonas fluorescens (strain Pf0-1)
Q3JNJ9 4.38e-126 380 42 5 496 3 araG Arabinose import ATP-binding protein AraG Burkholderia pseudomallei (strain 1710b)
Q63QQ7 6.83e-126 379 42 5 496 3 araG Arabinose import ATP-binding protein AraG Burkholderia pseudomallei (strain K96243)
Q1BPL3 1.04e-125 379 42 3 504 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia orbicola (strain AU 1054)
A0B1M7 1.04e-125 379 42 3 504 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia cenocepacia (strain HI2424)
Q62GY9 1.75e-125 378 42 5 496 3 araG Arabinose import ATP-binding protein AraG Burkholderia mallei (strain ATCC 23344)
Q39JR1 1.87e-125 378 41 5 496 3 araG1 Arabinose import ATP-binding protein AraG 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q2SZC2 2.22e-125 378 43 5 496 3 araG1 Arabinose import ATP-binding protein AraG 1 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2SVU4 3.09e-125 377 42 3 504 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q322L1 7.7e-125 377 41 4 496 3 araG Arabinose import ATP-binding protein AraG Shigella boydii serotype 4 (strain Sb227)
P0AAF3 1.09e-124 376 41 4 496 1 araG Arabinose import ATP-binding protein AraG Escherichia coli (strain K12)
P0AAF4 1.09e-124 376 41 4 496 3 araG Arabinose import ATP-binding protein AraG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAF5 1.09e-124 376 41 4 496 3 araG Arabinose import ATP-binding protein AraG Escherichia coli O157:H7
Q32HC7 2.53e-124 375 40 4 496 3 araG Arabinose import ATP-binding protein AraG Shigella dysenteriae serotype 1 (strain Sd197)
Q0TGT7 2.61e-124 375 40 4 496 3 araG Arabinose import ATP-binding protein AraG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q92UI2 2.91e-124 375 42 4 489 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium meliloti (strain 1021)
Q92UI2 2.87e-18 91 29 5 227 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium meliloti (strain 1021)
Q1RAN8 3.11e-124 375 40 4 496 3 araG Arabinose import ATP-binding protein AraG Escherichia coli (strain UTI89 / UPEC)
P32721 3.59e-124 375 40 6 507 3 alsA D-allose import ATP-binding protein AlsA Escherichia coli (strain K12)
Q3Z2S7 4.25e-124 375 40 4 496 3 araG Arabinose import ATP-binding protein AraG Shigella sonnei (strain Ss046)
Q83KP2 3.21e-123 372 41 5 498 3 araG Arabinose import ATP-binding protein AraG Shigella flexneri
Q1BZA2 3.67e-123 372 41 5 496 3 araG1 Arabinose import ATP-binding protein AraG 1 Burkholderia orbicola (strain AU 1054)
A0K4E8 3.67e-123 372 41 5 496 3 araG1 Arabinose import ATP-binding protein AraG 1 Burkholderia cenocepacia (strain HI2424)
Q8G847 4.68e-123 372 39 7 509 1 fruK Fructose import ATP-binding protein FruK Bifidobacterium longum (strain NCC 2705)
Q56342 1.09e-122 371 39 5 496 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema pallidum (strain Nichols)
Q56342 3.01e-17 87 25 4 233 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema pallidum (strain Nichols)
Q56342 7.68e-09 61 22 5 238 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema pallidum (strain Nichols)
Q0BIE1 2.26e-121 367 41 5 496 3 araG1 Arabinose import ATP-binding protein AraG 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q88J90 3.62e-121 367 39 5 502 3 rbsA Ribose import ATP-binding protein RbsA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q62K91 4.11e-120 364 41 3 504 3 rbsA Ribose import ATP-binding protein RbsA Burkholderia mallei (strain ATCC 23344)
Q11C01 4.58e-120 364 41 5 494 3 rbsA Ribose import ATP-binding protein RbsA Chelativorans sp. (strain BNC1)
Q11C01 2.41e-17 88 28 6 230 3 rbsA Ribose import ATP-binding protein RbsA Chelativorans sp. (strain BNC1)
P63299 1.83e-115 352 38 4 491 3 ytfR Galactofuranose transporter ATP-binding protein YtfR Escherichia coli O157:H7
P63299 3.49e-15 81 27 3 228 3 ytfR Galactofuranose transporter ATP-binding protein YtfR Escherichia coli O157:H7
Q6BEX0 2.3e-115 352 38 4 491 1 ytfR Galactofuranose transporter ATP-binding protein YtfR Escherichia coli (strain K12)
Q6BEX0 3.43e-15 81 27 3 230 1 ytfR Galactofuranose transporter ATP-binding protein YtfR Escherichia coli (strain K12)
Q3J3V9 3.34e-115 352 38 5 494 3 rbsA Ribose import ATP-binding protein RbsA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q3J3V9 1.87e-16 85 27 8 237 3 rbsA Ribose import ATP-binding protein RbsA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q3JSI8 9.28e-115 361 41 3 504 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia pseudomallei (strain 1710b)
Q98K15 1.01e-112 346 39 6 497 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q98K15 5.94e-16 84 24 2 231 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q1MHS1 2.23e-112 345 38 6 500 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1MHS1 3.06e-14 78 24 2 229 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q92MP8 5.98e-112 343 41 4 496 3 R02565 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium meliloti (strain 1021)
Q92MP8 9.73e-20 95 28 6 243 3 R02565 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium meliloti (strain 1021)
Q92MP8 3.27e-14 78 27 3 208 3 R02565 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Rhizobium meliloti (strain 1021)
Q1QYT1 5.11e-108 333 38 7 497 3 araG Arabinose import ATP-binding protein AraG Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q7N2D9 1.91e-106 330 38 9 511 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7N2D9 2.38e-15 82 25 6 238 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2K9A3 5.54e-105 326 37 6 497 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2K9A3 7.68e-13 74 23 2 229 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2PBM0 2.2e-103 322 38 9 512 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus luminescens
Q2PBM0 4.02e-15 81 25 7 250 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus luminescens
Q2PBM3 6.82e-101 315 37 9 510 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus temperata
Q2PBM3 2.35e-13 75 25 5 231 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus temperata
O05253 4.68e-100 313 36 5 509 1 nupO Guanosine import ATP-binding protein NupO Bacillus subtilis (strain 168)
P77257 2.19e-99 311 38 10 508 1 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain K12)
B1XEA1 2.19e-99 311 38 10 508 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain K12 / DH10B)
B1LFA2 5.28e-99 310 38 7 506 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain SMS-3-5 / SECEC)
B1IRU7 2.4e-98 308 38 10 508 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8XAY7 3.92e-98 308 38 10 508 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli O157:H7
Q83L12 6.57e-98 307 38 10 508 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Shigella flexneri
Q0T4L9 7.63e-98 307 38 10 508 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Shigella flexneri serotype 5b (strain 8401)
A6TEB8 9.16e-98 306 37 9 509 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A1JJ55 3.21e-97 306 37 10 518 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P77509 4.06e-97 305 37 10 498 3 yphE Uncharacterized ABC transporter ATP-binding protein YphE Escherichia coli (strain K12)
P77509 6.52e-15 80 24 4 232 3 yphE Uncharacterized ABC transporter ATP-binding protein YphE Escherichia coli (strain K12)
A8A066 5.61e-97 305 37 10 508 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Escherichia coli O9:H4 (strain HS)
A4WER4 2.24e-95 300 37 8 507 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Enterobacter sp. (strain 638)
Q66EY9 4.93e-95 300 36 7 509 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K3G1 4.93e-95 300 36 7 509 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B1JLQ0 5.61e-95 300 36 7 509 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TQL5 5.79e-95 300 36 6 514 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis (strain Pestoides F)
A4TQL5 2.43e-14 79 24 5 235 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis (strain Pestoides F)
Q1CN15 5.79e-95 300 36 6 514 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CN15 2.43e-14 79 24 5 235 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R074 5.79e-95 300 36 6 514 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis bv. Antiqua (strain Angola)
A9R074 2.43e-14 79 24 5 235 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis bv. Antiqua (strain Angola)
Q0WJP9 5.79e-95 300 36 6 514 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis
Q0WJP9 2.43e-14 79 24 5 235 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis
Q1C138 5.79e-95 300 36 6 514 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C138 2.43e-14 79 24 5 235 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMJ7 7.49e-95 300 36 7 509 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
D4GPW3 8.5e-93 295 33 6 524 3 tsgD13 Glucose import ATP-binding protein TsgD13 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
D4GPW3 1.98e-14 79 26 6 265 3 tsgD13 Glucose import ATP-binding protein TsgD13 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q8Z2X5 1.35e-92 294 35 9 512 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella typhi
Q8ZKQ4 3.29e-92 293 35 10 512 1 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9MZG1 5.93e-92 292 35 10 512 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJE7 5.93e-92 292 35 10 512 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P0C886 6.67e-92 292 35 9 512 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Salmonella choleraesuis (strain SC-B67)
A2RKA7 1.78e-85 275 33 4 501 1 nupA Nucleoside import ATP-binding protein NupA Lactococcus lactis subsp. cremoris (strain MG1363)
A2RKA7 6.4e-13 74 28 3 224 1 nupA Nucleoside import ATP-binding protein NupA Lactococcus lactis subsp. cremoris (strain MG1363)
P55570 3.18e-72 240 33 13 497 3 NGR_a02480 Uncharacterized ABC transporter ATP-binding protein y4mK Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A7ZLX1 6.83e-57 195 38 4 310 5 lsrA Putative autoinducer 2 import ATP-binding protein LsrA homolog Escherichia coli O139:H28 (strain E24377A / ETEC)
A7ZLX1 7.63e-18 88 27 5 237 5 lsrA Putative autoinducer 2 import ATP-binding protein LsrA homolog Escherichia coli O139:H28 (strain E24377A / ETEC)
Q9F9B0 8.32e-44 158 37 3 248 1 frcA Fructose import ATP-binding protein FrcA Rhizobium meliloti
Q9F9B0 5.97e-21 95 32 5 208 1 frcA Fructose import ATP-binding protein FrcA Rhizobium meliloti
P0DTT6 6.06e-43 155 37 2 238 1 xylG Xylose/arabinose import ATP-binding protein XylG Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
P0DTT6 6.89e-17 83 27 6 246 1 xylG Xylose/arabinose import ATP-binding protein XylG Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
P75516 1.74e-41 159 34 4 271 3 MPN_258 Putative carbohydrate transport ATP-binding protein MPN_258 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P75516 3.1e-20 97 30 9 260 3 MPN_258 Putative carbohydrate transport ATP-binding protein MPN_258 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P75516 4.94e-12 72 23 4 235 3 MPN_258 Putative carbohydrate transport ATP-binding protein MPN_258 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47365 2.58e-37 147 35 5 245 3 MG119 Putative carbohydrate transport ATP-binding protein MG119 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P47365 7.31e-20 96 29 3 209 3 MG119 Putative carbohydrate transport ATP-binding protein MG119 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P47365 2.63e-11 69 24 3 226 3 MG119 Putative carbohydrate transport ATP-binding protein MG119 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q8G838 1.74e-35 144 25 15 530 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8G838 2.29e-13 76 27 6 227 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8G838 3.44e-11 69 27 5 234 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8TQW9 4.43e-30 126 25 15 497 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQW9 2.57e-17 88 26 4 222 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8PUE7 1.09e-29 125 24 13 489 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PUE7 1.14e-13 76 24 4 224 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q1LQF6 2.22e-28 118 29 7 282 3 metN Methionine import ATP-binding protein MetN Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q1LQF6 1.17e-13 75 28 7 212 3 metN Methionine import ATP-binding protein MetN Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q0KDG3 3.78e-28 118 30 7 282 3 metN Methionine import ATP-binding protein MetN Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q0KDG3 2.57e-14 77 28 7 218 3 metN Methionine import ATP-binding protein MetN Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P0A9S9 6.9e-28 115 30 6 230 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Shigella flexneri
P0A9S9 4.72e-12 69 26 5 220 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Shigella flexneri
P0A9S7 6.9e-28 115 30 6 230 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Escherichia coli (strain K12)
P0A9S7 4.72e-12 69 26 5 220 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Escherichia coli (strain K12)
P0A9S8 6.9e-28 115 30 6 230 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Escherichia coli O157:H7
P0A9S8 4.72e-12 69 26 5 220 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Escherichia coli O157:H7
Q6G2E2 2.06e-27 115 29 7 293 3 metN Methionine import ATP-binding protein MetN Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q6G2E2 6.73e-16 82 29 8 221 3 metN Methionine import ATP-binding protein MetN Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q46Y69 8.07e-27 114 29 7 282 3 metN Methionine import ATP-binding protein MetN Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q46Y69 7.87e-15 79 28 5 214 3 metN Methionine import ATP-binding protein MetN Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q58663 4.08e-26 110 30 4 250 1 livG Probable branched-chain amino acid transport ATP-binding protein LivG Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q58663 1.51e-13 73 25 3 236 1 livG Probable branched-chain amino acid transport ATP-binding protein LivG Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q83LR7 4.98e-26 115 31 4 231 3 macB Macrolide export ATP-binding/permease protein MacB Shigella flexneri
Q83LR7 3.52e-11 69 23 7 232 3 macB Macrolide export ATP-binding/permease protein MacB Shigella flexneri
Q12B04 5.54e-26 112 31 5 255 3 metN Methionine import ATP-binding protein MetN Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q12B04 5.2e-14 77 30 7 208 3 metN Methionine import ATP-binding protein MetN Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q0C1C3 6.75e-26 108 31 5 228 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Hyphomonas neptunium (strain ATCC 15444)
Q0C1C3 8.85e-10 62 27 9 201 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Hyphomonas neptunium (strain ATCC 15444)
Q6HI76 1.08e-25 114 24 20 538 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HI76 1.42e-17 89 27 2 224 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
P0A193 1.23e-25 108 30 6 230 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A193 2.73e-13 73 27 5 220 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A194 1.23e-25 108 30 6 230 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Salmonella typhi
P0A194 2.73e-13 73 27 5 220 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Salmonella typhi
Q81PZ8 2.59e-25 112 24 20 538 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q81PZ8 8.72e-18 89 27 2 224 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
A0KMJ3 2.76e-25 113 31 5 235 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A0KMJ3 4.66e-10 65 25 7 220 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q9CM47 2.96e-25 113 32 5 234 3 macB Macrolide export ATP-binding/permease protein MacB Pasteurella multocida (strain Pm70)
Q9CM47 1.03e-09 64 23 4 222 3 macB Macrolide export ATP-binding/permease protein MacB Pasteurella multocida (strain Pm70)
Q81CT8 3.06e-25 112 24 17 527 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81CT8 1.61e-17 89 27 2 226 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q44848 3.39e-25 112 22 12 498 3 BB_0318 Uncharacterized ABC transporter ATP-binding protein BB_0318 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
P21629 3.59e-25 107 28 4 243 3 braF High-affinity branched-chain amino acid transport ATP-binding protein BraF Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P21629 4.7e-16 81 26 4 214 3 braF High-affinity branched-chain amino acid transport ATP-binding protein BraF Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A1K323 4.18e-25 112 31 5 229 3 macB Macrolide export ATP-binding/permease protein MacB Azoarcus sp. (strain BH72)
A1K323 1.42e-12 73 28 6 219 3 macB Macrolide export ATP-binding/permease protein MacB Azoarcus sp. (strain BH72)
P0AAF9 5.91e-25 106 31 2 231 3 artP Arginine transport ATP-binding protein ArtP Shigella flexneri
P0AAF9 2.56e-11 67 25 6 212 3 artP Arginine transport ATP-binding protein ArtP Shigella flexneri
P0AAF6 5.91e-25 106 31 2 231 1 artP Arginine transport ATP-binding protein ArtP Escherichia coli (strain K12)
P0AAF6 2.56e-11 67 25 6 212 1 artP Arginine transport ATP-binding protein ArtP Escherichia coli (strain K12)
P0AAF7 5.91e-25 106 31 2 231 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAF7 2.56e-11 67 25 6 212 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAF8 5.91e-25 106 31 2 231 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O157:H7
P0AAF8 2.56e-11 67 25 6 212 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O157:H7
Q5WVL8 6.37e-25 108 30 4 249 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Lens)
Q5WVL8 6.82e-13 73 30 4 218 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Lens)
Q21XK2 7.4e-25 108 30 5 253 3 metN Methionine import ATP-binding protein MetN Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q21XK2 7.9e-10 63 27 6 217 3 metN Methionine import ATP-binding protein MetN Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q88RL5 8.84e-25 108 32 4 217 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88RL5 1.83e-14 78 27 9 226 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q5ZUG5 9.56e-25 108 29 4 249 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5ZUG5 4.56e-13 73 30 4 218 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q97KD5 1.1e-24 107 28 4 250 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q97KD5 1.26e-12 72 28 6 236 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q5X484 1.11e-24 108 29 4 249 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Paris)
Q5X484 1.52e-13 75 31 5 218 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Paris)
Q8F6Z1 1.34e-24 108 29 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q8F6Z1 8.94e-14 76 24 6 221 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PE5 1.34e-24 108 29 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q72PE5 8.94e-14 76 24 6 221 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q32DZ9 1.83e-24 110 31 4 234 3 macB Macrolide export ATP-binding/permease protein MacB Shigella dysenteriae serotype 1 (strain Sd197)
Q32DZ9 2.75e-10 66 22 7 232 3 macB Macrolide export ATP-binding/permease protein MacB Shigella dysenteriae serotype 1 (strain Sd197)
Q0SFY5 2.03e-24 107 31 6 247 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodococcus jostii (strain RHA1)
Q0SFY5 5.12e-14 76 29 6 219 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodococcus jostii (strain RHA1)
Q8XED0 2.09e-24 110 31 4 231 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O157:H7
Q8XED0 6.44e-10 65 22 7 232 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O157:H7
Q9A502 2.3e-24 107 33 3 206 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9A502 1.51e-15 81 30 6 210 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P75831 2.95e-24 110 31 4 231 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain K12)
P75831 1.47e-10 67 23 7 232 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain K12)
Q3Z3Q4 2.97e-24 110 31 4 231 3 macB Macrolide export ATP-binding/permease protein MacB Shigella sonnei (strain Ss046)
Q3Z3Q4 9.78e-11 67 23 7 232 3 macB Macrolide export ATP-binding/permease protein MacB Shigella sonnei (strain Ss046)
Q0TJH0 2.97e-24 110 31 4 231 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TJH0 1.21e-10 67 23 7 232 1 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1RE44 3.14e-24 110 31 4 231 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain UTI89 / UPEC)
Q1RE44 1.2e-10 67 23 7 232 3 macB Macrolide export ATP-binding/permease protein MacB Escherichia coli (strain UTI89 / UPEC)
A1A9B7 3.14e-24 110 31 4 231 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Escherichia coli O1:K1 / APEC
A1A9B7 1.2e-10 67 23 7 232 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Escherichia coli O1:K1 / APEC
Q4KKK8 4.66e-24 106 30 5 234 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4KKK8 1.1e-12 72 27 8 224 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q8KLG1 4.76e-24 105 29 3 229 3 nodI Nod factor export ATP-binding protein I Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8KLG1 6.34e-15 79 26 5 230 3 nodI Nod factor export ATP-binding protein I Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q0BH79 4.87e-24 106 29 6 265 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q0BH79 2.2e-17 87 28 4 214 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q9TKX3 5.13e-24 106 31 4 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nephroselmis olivacea
Q9TKX3 3.14e-12 71 24 5 209 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nephroselmis olivacea
Q6RCE0 5.18e-24 104 28 8 259 3 phnC Phosphonates import ATP-binding protein PhnC Stutzerimonas stutzeri
Q6RCE0 1.67e-07 56 23 6 215 3 phnC Phosphonates import ATP-binding protein PhnC Stutzerimonas stutzeri
Q7WGW1 5.25e-24 106 27 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7WGW1 3.69e-14 77 26 6 210 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P96605 5.27e-24 105 26 6 290 3 ydbJ Uncharacterized ABC transporter ATP-binding protein YdbJ Bacillus subtilis (strain 168)
P96605 5.76e-13 73 25 5 220 3 ydbJ Uncharacterized ABC transporter ATP-binding protein YdbJ Bacillus subtilis (strain 168)
Q7W9U5 5.3e-24 106 27 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7W9U5 1.95e-14 78 26 6 210 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q1IGZ0 5.43e-24 106 30 5 234 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas entomophila (strain L48)
Q1IGZ0 1.56e-15 81 27 6 219 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas entomophila (strain L48)
P56344 5.8e-24 103 29 4 239 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
P56344 3.36e-11 66 22 6 205 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
Q8Y0X3 6.92e-24 105 28 6 276 3 metN Methionine import ATP-binding protein MetN Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8Y0X3 2.47e-16 84 29 5 217 3 metN Methionine import ATP-binding protein MetN Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q323M3 7.37e-24 108 31 4 231 3 macB Macrolide export ATP-binding/permease protein MacB Shigella boydii serotype 4 (strain Sb227)
Q323M3 7.87e-10 65 22 7 232 3 macB Macrolide export ATP-binding/permease protein MacB Shigella boydii serotype 4 (strain Sb227)
Q7VZE5 7.41e-24 105 27 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7VZE5 2.17e-14 78 26 6 210 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q1BY14 7.88e-24 105 28 5 265 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia orbicola (strain AU 1054)
Q1BY14 7.1e-17 85 28 4 214 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia orbicola (strain AU 1054)
A0K5N5 7.88e-24 105 28 5 265 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia cenocepacia (strain HI2424)
A0K5N5 7.1e-17 85 28 4 214 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia cenocepacia (strain HI2424)
Q9AB70 9.98e-24 103 29 7 258 3 phnC Phosphonates import ATP-binding protein PhnC Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9AB70 2.18e-08 58 22 5 235 3 phnC Phosphonates import ATP-binding protein PhnC Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q882S0 1.15e-23 103 27 7 277 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q882S0 7.83e-11 66 24 7 231 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q7N8M2 1.25e-23 105 31 4 232 3 metN Methionine import ATP-binding protein MetN Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7N8M2 2.86e-13 74 28 5 209 3 metN Methionine import ATP-binding protein MetN Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P45073 1.33e-23 102 26 1 218 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45073 9.46e-17 83 26 5 230 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8PNN4 1.34e-23 105 30 5 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas axonopodis pv. citri (strain 306)
Q8PNN4 2.36e-13 74 25 7 211 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas axonopodis pv. citri (strain 306)
Q8DIA0 1.52e-23 104 29 3 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8DIA0 6.48e-13 73 24 5 207 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q609Q1 1.79e-23 104 30 3 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q609Q1 1.52e-13 75 26 6 219 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q39IE7 2.16e-23 104 28 5 265 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q39IE7 1.55e-14 78 27 4 214 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q9MUN1 2.18e-23 104 30 3 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
Q9MUN1 7.97e-13 73 26 6 210 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
Q38WL5 2.52e-23 104 31 6 253 3 metN Methionine import ATP-binding protein MetN Latilactobacillus sakei subsp. sakei (strain 23K)
Q38WL5 2.53e-16 83 29 6 219 3 metN Methionine import ATP-binding protein MetN Latilactobacillus sakei subsp. sakei (strain 23K)
Q13VD7 2.96e-23 103 29 5 265 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
Q13VD7 1.3e-13 75 27 6 214 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
Q7VI92 3.61e-23 103 29 5 231 3 metN Methionine import ATP-binding protein MetN Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q7VI92 2.59e-12 71 26 7 217 3 metN Methionine import ATP-binding protein MetN Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q73F11 3.66e-23 103 31 4 232 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q73F11 3.05e-12 71 28 5 210 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q2KVK2 4.06e-23 103 30 5 226 3 metN Methionine import ATP-binding protein MetN Bordetella avium (strain 197N)
Q2KVK2 4.33e-07 55 24 7 210 3 metN Methionine import ATP-binding protein MetN Bordetella avium (strain 197N)
Q92WJ0 4.46e-23 103 29 3 225 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhizobium meliloti (strain 1021)
Q92WJ0 4.04e-16 83 26 7 227 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhizobium meliloti (strain 1021)
Q6LN52 4.56e-23 103 29 5 256 3 metN Methionine import ATP-binding protein MetN Photobacterium profundum (strain SS9)
Q6LN52 2.59e-12 71 28 7 211 3 metN Methionine import ATP-binding protein MetN Photobacterium profundum (strain SS9)
Q93DX8 4.75e-23 101 27 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q93DX8 2.27e-11 67 25 8 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q8Z0H0 4.85e-23 103 29 3 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8Z0H0 7.22e-13 73 24 7 222 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q7N6Z2 5.51e-23 103 28 2 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7N6Z2 2.94e-14 77 26 6 207 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6F9P2 5.64e-23 103 29 6 234 3 metN2 Methionine import ATP-binding protein MetN 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q6F9P2 1.91e-12 72 26 8 223 3 metN2 Methionine import ATP-binding protein MetN 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q8PC11 6.1e-23 103 30 4 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8PC11 1.87e-14 78 26 8 211 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4ZU82 6.13e-23 101 28 6 252 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. syringae (strain B728a)
Q4ZU82 2.85e-10 64 23 7 231 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. syringae (strain B728a)
Q1LPJ9 6.5e-23 100 32 6 231 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q1LPJ9 1.05e-06 53 33 2 84 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q8EEV5 7.66e-23 100 31 5 207 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8EEV5 7.93e-11 65 27 8 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q080S4 8.64e-23 100 30 5 209 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella frigidimarina (strain NCIMB 400)
Q080S4 9.68e-12 68 27 7 207 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella frigidimarina (strain NCIMB 400)
Q81IZ6 9.8e-23 102 31 4 232 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81IZ6 4.38e-13 73 28 5 212 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q0HVQ0 9.81e-23 100 31 5 204 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella sp. (strain MR-7)
Q0HVQ0 6.25e-11 65 26 7 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella sp. (strain MR-7)
Q3KK97 1.04e-22 102 28 5 239 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain Pf0-1)
Q3KK97 4.07e-14 77 28 9 225 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain Pf0-1)
Q7NQN5 1.1e-22 102 31 3 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7NQN5 6.46e-18 88 26 5 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q48HL2 1.16e-22 100 28 6 252 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q48HL2 5.72e-11 66 24 7 231 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8PGE8 1.21e-22 102 31 4 216 3 metN Methionine import ATP-binding protein MetN Xanthomonas axonopodis pv. citri (strain 306)
Q8PGE8 7.48e-12 70 27 6 216 3 metN Methionine import ATP-binding protein MetN Xanthomonas axonopodis pv. citri (strain 306)
Q82WT5 1.41e-22 102 26 4 247 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q82WT5 4.2e-15 80 27 7 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q88WA5 1.66e-22 102 30 5 237 3 metN1 Methionine import ATP-binding protein MetN 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88WA5 2.15e-20 95 30 4 211 3 metN1 Methionine import ATP-binding protein MetN 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q6NJ07 1.72e-22 102 31 4 223 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q6NJ07 1.46e-14 78 28 6 225 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q65VG9 1.98e-22 101 29 5 240 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q65VG9 2.63e-13 74 29 9 216 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7NIW1 2.1e-22 101 29 3 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q7NIW1 4.29e-11 67 24 8 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q8FV85 2.16e-22 102 31 4 226 3 metN Methionine import ATP-binding protein MetN Brucella suis biovar 1 (strain 1330)
Q8FV85 2.61e-14 77 28 6 219 3 metN Methionine import ATP-binding protein MetN Brucella suis biovar 1 (strain 1330)
Q8YD40 2.16e-22 102 31 4 226 3 metN Methionine import ATP-binding protein MetN Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8YD40 2.61e-14 77 28 6 219 3 metN Methionine import ATP-binding protein MetN Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q579H8 2.16e-22 102 31 4 226 3 metN Methionine import ATP-binding protein MetN Brucella abortus biovar 1 (strain 9-941)
Q579H8 2.61e-14 77 28 6 219 3 metN Methionine import ATP-binding protein MetN Brucella abortus biovar 1 (strain 9-941)
Q2YIV5 2.16e-22 102 31 4 226 3 metN Methionine import ATP-binding protein MetN Brucella abortus (strain 2308)
Q2YIV5 2.61e-14 77 28 6 219 3 metN Methionine import ATP-binding protein MetN Brucella abortus (strain 2308)
Q1GIE5 2.41e-22 102 32 4 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Ruegeria sp. (strain TM1040)
Q1GIE5 6.51e-16 82 24 5 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Ruegeria sp. (strain TM1040)
Q81VM2 2.45e-22 101 31 4 232 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus anthracis
Q81VM2 2.12e-12 72 29 7 213 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus anthracis
Q8P4S7 2.55e-22 101 30 5 217 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8P4S7 4.41e-13 73 27 7 214 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UQD2 2.55e-22 101 30 5 217 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain 8004)
Q4UQD2 4.41e-13 73 27 7 214 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain 8004)
Q2K8C8 2.55e-22 101 28 4 241 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2K8C8 1.86e-12 72 25 5 208 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q6MIP7 2.6e-22 99 28 6 245 3 phnC Phosphonates import ATP-binding protein PhnC Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q6MIP7 8.91e-09 60 24 8 232 3 phnC Phosphonates import ATP-binding protein PhnC Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
P46903 2.63e-22 99 28 4 236 1 natA ABC transporter ATP-binding protein NatA Bacillus subtilis (strain 168)
P46903 5.53e-18 86 27 2 214 1 natA ABC transporter ATP-binding protein NatA Bacillus subtilis (strain 168)
Q3A9G5 2.65e-22 101 30 5 228 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q3A9G5 1.05e-17 87 27 7 252 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q1DDP4 2.67e-22 101 27 4 232 3 metN Methionine import ATP-binding protein MetN Myxococcus xanthus (strain DK1622)
Q1DDP4 5.99e-12 70 28 8 223 3 metN Methionine import ATP-binding protein MetN Myxococcus xanthus (strain DK1622)
Q17VE0 2.81e-22 100 28 4 221 3 metN Methionine import ATP-binding protein MetN Helicobacter acinonychis (strain Sheeba)
Q17VE0 5.39e-09 61 25 7 215 3 metN Methionine import ATP-binding protein MetN Helicobacter acinonychis (strain Sheeba)
P37624 2.82e-22 104 23 17 501 1 rbbA Ribosome-associated ATPase Escherichia coli (strain K12)
P37624 9.98e-14 77 24 3 227 1 rbbA Ribosome-associated ATPase Escherichia coli (strain K12)
Q3YUN6 2.86e-22 99 28 6 230 3 phnC Phosphonates import ATP-binding protein PhnC Shigella sonnei (strain Ss046)
Q3YUN6 1.49e-11 68 22 6 219 3 phnC Phosphonates import ATP-binding protein PhnC Shigella sonnei (strain Ss046)
Q9CK97 2.99e-22 101 30 5 234 3 metN Methionine import ATP-binding protein MetN Pasteurella multocida (strain Pm70)
Q9CK97 1.51e-13 75 28 6 209 3 metN Methionine import ATP-binding protein MetN Pasteurella multocida (strain Pm70)
Q667L9 3.03e-22 101 30 4 232 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q667L9 2.27e-15 80 30 6 209 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q9G4F5 3.05e-22 101 26 2 215 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
Q9G4F5 1.41e-15 81 26 7 221 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
Q827Y0 3.15e-22 101 30 4 221 3 metN Methionine import ATP-binding protein MetN Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q827Y0 1.13e-13 75 31 8 229 3 metN Methionine import ATP-binding protein MetN Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q5LUD0 3.27e-22 98 31 6 231 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q5LUD0 1.85e-07 55 36 2 82 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q8YUV1 3.28e-22 99 26 3 241 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8YUV1 5.8e-09 60 25 5 213 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8UCD5 3.47e-22 101 30 3 197 3 modC Molybdenum import ATP-binding protein ModC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8UCD5 2.03e-14 78 26 8 223 3 modC Molybdenum import ATP-binding protein ModC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q5PGK9 3.49e-22 103 29 4 234 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PGK9 1.5e-14 80 25 4 246 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q63S19 3.59e-22 100 27 6 267 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain K96243)
Q63S19 1.33e-15 81 28 6 214 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain K96243)
Q3JPZ4 3.59e-22 100 27 6 267 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain 1710b)
Q3JPZ4 1.33e-15 81 28 6 214 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain 1710b)
Q62M41 3.59e-22 100 27 6 267 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia mallei (strain ATCC 23344)
Q62M41 1.33e-15 81 28 6 214 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia mallei (strain ATCC 23344)
Q578K3 3.63e-22 101 30 4 225 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus biovar 1 (strain 9-941)
Q578K3 7.12e-12 70 26 5 206 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus biovar 1 (strain 9-941)
Q2YKX3 3.63e-22 101 30 4 225 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus (strain 2308)
Q2YKX3 7.12e-12 70 26 5 206 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus (strain 2308)
O34814 3.71e-22 98 29 3 217 1 ftsE Cell division ATP-binding protein FtsE Bacillus subtilis (strain 168)
O34814 4.95e-13 72 28 6 207 1 ftsE Cell division ATP-binding protein FtsE Bacillus subtilis (strain 168)
Q8Z824 3.75e-22 103 29 4 234 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhi
Q8Z824 1.53e-14 80 25 4 246 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhi
Q8ZQE4 4e-22 103 29 4 234 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZQE4 1.54e-14 80 25 4 246 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q6D1C4 4.28e-22 100 31 5 234 3 metN3 Methionine import ATP-binding protein MetN 3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D1C4 3.9e-13 73 28 6 210 3 metN3 Methionine import ATP-binding protein MetN 3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9HT70 4.97e-22 100 29 4 222 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9HT70 1.4e-09 63 26 6 211 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DK6 4.97e-22 100 29 4 222 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q02DK6 1.4e-09 63 26 6 211 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q8UH62 5.25e-22 100 28 2 215 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8UH62 6.14e-14 76 27 8 220 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q0HJG0 5.47e-22 97 30 5 204 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella sp. (strain MR-4)
Q0HJG0 1.3e-11 67 26 7 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella sp. (strain MR-4)
Q48PU6 6.43e-22 100 28 5 239 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q48PU6 1.92e-12 72 27 8 217 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q57S53 6.65e-22 100 28 6 248 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella choleraesuis (strain SC-B67)
Q57S53 4.28e-15 80 27 5 215 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella choleraesuis (strain SC-B67)
Q3BNZ3 6.87e-22 100 31 4 216 3 metN Methionine import ATP-binding protein MetN Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q3BNZ3 1.29e-11 69 27 7 214 3 metN Methionine import ATP-binding protein MetN Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q4ZZR8 6.87e-22 100 28 5 239 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. syringae (strain B728a)
Q4ZZR8 1.53e-12 72 27 8 217 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. syringae (strain B728a)
Q89UD2 7.32e-22 100 26 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q89UD2 2.11e-13 75 26 7 223 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9KTJ5 7.46e-22 100 28 5 232 3 metN Methionine import ATP-binding protein MetN Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9KTJ5 4.96e-10 64 27 8 211 3 metN Methionine import ATP-binding protein MetN Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9K876 7.66e-22 100 28 4 245 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9K876 1.04e-16 85 29 8 209 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q87DT9 7.82e-22 100 29 5 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q87DT9 4.14e-14 77 25 6 208 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q63H29 8.2e-22 100 31 4 232 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ZK / E33L)
Q63H29 2.2e-12 72 29 7 213 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ZK / E33L)
Q2RWA3 8.54e-22 100 29 5 256 3 metN Methionine import ATP-binding protein MetN Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q2RWA3 1.42e-11 69 27 7 213 3 metN Methionine import ATP-binding protein MetN Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
O28881 9.5e-22 97 26 4 245 3 livG Probable branched-chain amino acid transport ATP-binding protein LivG Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O28881 4.19e-09 60 26 4 225 3 livG Probable branched-chain amino acid transport ATP-binding protein LivG Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P36879 1.01e-21 99 29 5 219 1 yadG Uncharacterized ABC transporter ATP-binding protein YadG Escherichia coli (strain K12)
P36879 1.12e-09 63 34 1 95 1 yadG Uncharacterized ABC transporter ATP-binding protein YadG Escherichia coli (strain K12)
Q5PCG9 1.02e-21 99 28 6 248 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PCG9 1.5e-14 78 27 5 215 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P94440 1.13e-21 99 27 3 239 1 lnrL Linearmycin resistance ATP-binding protein LnrL Bacillus subtilis (strain 168)
P94440 3.73e-15 79 27 3 206 1 lnrL Linearmycin resistance ATP-binding protein LnrL Bacillus subtilis (strain 168)
Q8YCG3 1.16e-21 99 30 4 225 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8YCG3 6.9e-13 73 26 5 206 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P9WQL3 1.16e-21 100 32 6 209 1 modC Molybdenum import ATP-binding protein ModC Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQL3 1.97e-14 78 28 6 214 1 modC Molybdenum import ATP-binding protein ModC Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQL2 1.16e-21 100 32 6 209 3 modC Molybdenum import ATP-binding protein ModC Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WQL2 1.97e-14 78 28 6 214 3 modC Molybdenum import ATP-binding protein ModC Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q02ME3 1.18e-21 99 29 5 234 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q02ME3 3.92e-13 74 27 6 211 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q7VV72 1.19e-21 99 30 3 206 3 metN Methionine import ATP-binding protein MetN Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7VV72 1.52e-08 60 24 6 208 3 metN Methionine import ATP-binding protein MetN Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W4E1 1.19e-21 99 30 3 206 3 metN Methionine import ATP-binding protein MetN Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7W4E1 1.52e-08 60 24 6 208 3 metN Methionine import ATP-binding protein MetN Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFU9 1.19e-21 99 30 3 206 3 metN Methionine import ATP-binding protein MetN Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7WFU9 1.52e-08 60 24 6 208 3 metN Methionine import ATP-binding protein MetN Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7UPK3 1.2e-21 97 35 9 229 3 lolD2 Lipoprotein-releasing system ATP-binding protein LolD 2 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q7UPK3 1.62e-06 53 37 2 77 3 lolD2 Lipoprotein-releasing system ATP-binding protein LolD 2 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q87UN4 1.23e-21 99 28 5 239 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q87UN4 2.2e-12 71 26 9 220 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q2P7S3 1.24e-21 99 31 5 217 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q2P7S3 1.23e-10 66 26 7 212 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q7M8U0 1.26e-21 102 33 6 227 3 macB Macrolide export ATP-binding/permease protein MacB Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q7M8U0 1.32e-08 61 39 1 79 3 macB Macrolide export ATP-binding/permease protein MacB Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q57R58 1.29e-21 102 29 4 234 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella choleraesuis (strain SC-B67)
Q57R58 8.94e-15 80 25 4 246 3 macB Macrolide export ATP-binding/permease protein MacB Salmonella choleraesuis (strain SC-B67)
Q8ES39 1.3e-21 101 24 20 514 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q5H503 1.46e-21 99 31 5 217 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q5H503 6.81e-11 67 26 7 212 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q9K8N1 1.67e-21 97 27 7 252 3 phnC3 Phosphonates import ATP-binding protein PhnC 3 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9K8N1 1.48e-10 65 25 7 241 3 phnC3 Phosphonates import ATP-binding protein PhnC 3 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q63TY1 1.71e-21 99 26 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
Q63TY1 2.89e-12 71 25 7 225 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
Q62K82 1.76e-21 99 26 2 215 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
Q62K82 3.4e-12 71 25 7 225 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
Q0A8P9 1.79e-21 96 28 5 229 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q0A8P9 1.09e-09 62 39 2 84 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q8ZR89 1.99e-21 98 28 6 248 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZR89 4.24e-15 80 27 5 215 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q2SY12 2.16e-21 98 27 5 265 3 metN Methionine import ATP-binding protein MetN Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2SY12 1.68e-15 81 29 6 214 3 metN Methionine import ATP-binding protein MetN Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q7NX01 2.2e-21 99 27 2 215 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7NX01 8.07e-14 76 25 5 207 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8RQL7 2.24e-21 96 28 2 218 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8RQL7 6.86e-15 77 26 4 207 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q0T9T7 2.25e-21 97 28 6 230 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0T9T7 2.55e-11 67 22 6 219 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q03P57 2.36e-21 99 31 7 247 3 metN Methionine import ATP-binding protein MetN Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q03P57 4.49e-19 92 30 4 207 3 metN Methionine import ATP-binding protein MetN Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q6D3Q6 2.64e-21 98 27 7 266 3 metN2 Methionine import ATP-binding protein MetN 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D3Q6 8.12e-16 82 29 6 214 3 metN2 Methionine import ATP-binding protein MetN 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8XK20 2.66e-21 100 24 19 540 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8XK20 6.1e-19 93 29 7 259 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q1CFH7 3.09e-21 98 30 4 232 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CFH7 1.82e-14 78 30 6 209 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZH38 3.09e-21 98 30 4 232 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis
Q8ZH38 1.82e-14 78 30 6 209 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis
Q1CAK4 3.09e-21 98 30 4 232 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Antiqua)
Q1CAK4 1.82e-14 78 30 6 209 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Antiqua)
Q9I6L0 3.18e-21 97 25 3 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9I6L0 3.61e-13 73 24 6 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9PDN2 3.18e-21 98 28 4 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain 9a5c)
Q9PDN2 2.76e-15 80 26 5 205 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain 9a5c)
O68106 3.31e-21 97 27 7 281 1 cbiO Cobalt import ATP-binding protein CbiO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
O68106 1.22e-15 80 25 4 229 1 cbiO Cobalt import ATP-binding protein CbiO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q1R3F6 3.31e-21 96 26 5 234 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain UTI89 / UPEC)
Q1R3F6 5.27e-11 66 22 6 219 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain UTI89 / UPEC)
Q1I7I9 3.32e-21 100 31 5 234 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas entomophila (strain L48)
Q1I7I9 1.75e-09 63 26 7 216 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas entomophila (strain L48)
Q8UKE4 3.37e-21 100 30 5 232 3 macB Macrolide export ATP-binding/permease protein MacB Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8UKE4 7.87e-10 65 26 7 213 3 macB Macrolide export ATP-binding/permease protein MacB Agrobacterium fabrum (strain C58 / ATCC 33970)
Q329I3 3.51e-21 96 26 5 234 3 phnC Phosphonates import ATP-binding protein PhnC Shigella dysenteriae serotype 1 (strain Sd197)
Q329I3 3.47e-11 67 22 6 220 3 phnC Phosphonates import ATP-binding protein PhnC Shigella dysenteriae serotype 1 (strain Sd197)
Q0ASQ1 3.58e-21 96 28 6 247 3 phnC Phosphonates import ATP-binding protein PhnC Maricaulis maris (strain MCS10)
Q0ASQ1 5.28e-08 57 24 5 231 3 phnC Phosphonates import ATP-binding protein PhnC Maricaulis maris (strain MCS10)
P16677 3.61e-21 96 26 5 234 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain K12)
P16677 1.12e-10 65 24 8 223 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain K12)
O26096 3.84e-21 97 26 6 284 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain ATCC 700392 / 26695)
O26096 2.59e-09 62 26 6 215 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain ATCC 700392 / 26695)
Q9K789 3.9e-21 97 29 4 232 3 metN Methionine import ATP-binding protein MetN Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9K789 5.18e-12 70 27 6 218 3 metN Methionine import ATP-binding protein MetN Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8FAV1 3.9e-21 96 26 5 234 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FAV1 6.17e-11 66 22 6 219 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q73P71 3.94e-21 96 28 7 231 3 phnC Phosphonates import ATP-binding protein PhnC Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73P71 5.71e-12 69 24 7 237 3 phnC Phosphonates import ATP-binding protein PhnC Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q9ZJ34 3.99e-21 97 26 6 283 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain J99 / ATCC 700824)
Q9ZJ34 3.37e-09 62 25 6 215 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain J99 / ATCC 700824)
Q8U6M1 4.03e-21 98 27 5 243 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8U6M1 3.24e-13 74 26 5 208 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q67SV5 4.25e-21 97 29 5 234 3 metN Methionine import ATP-binding protein MetN Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q67SV5 2.25e-10 65 26 6 211 3 metN Methionine import ATP-binding protein MetN Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P72335 4.28e-21 97 29 3 230 3 nodI Nod factor export ATP-binding protein I Rhizobium sp. (strain N33)
P72335 6.28e-16 82 28 4 218 3 nodI Nod factor export ATP-binding protein I Rhizobium sp. (strain N33)
Q7CJG3 4.52e-21 100 29 4 228 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis
Q7CJG3 1.3e-10 67 24 3 208 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis
Q1C5W7 4.52e-21 100 29 4 228 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C5W7 1.3e-10 67 24 3 208 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pestis bv. Antiqua (strain Antiqua)
Q1CJW8 4.52e-21 100 29 4 228 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CJW8 1.3e-10 67 24 3 208 3 macB1 Macrolide export ATP-binding/permease protein MacB 1 Yersinia pestis bv. Antiqua (strain Nepal516)
Q4K9A4 4.56e-21 100 31 6 240 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4K9A4 2.65e-08 60 25 8 216 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q668L6 4.82e-21 100 29 4 228 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q668L6 1.34e-10 67 24 3 208 3 macB2 Macrolide export ATP-binding/permease protein MacB 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
P14788 4.98e-21 97 28 3 215 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P14788 1.59e-13 75 24 5 207 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q1CR30 5.01e-21 97 26 6 284 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain HPAG1)
Q1CR30 2.5e-09 62 26 6 215 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain HPAG1)
A0A0H2ZLL3 5.31e-21 95 28 6 241 3 egtUA Probable ergothioneine transport ATP-binding protein EgtUA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A0A0H2ZLL3 1.98e-15 79 27 7 212 3 egtUA Probable ergothioneine transport ATP-binding protein EgtUA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P44531 5.38e-21 97 29 4 226 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44531 4.97e-14 76 26 8 223 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q39GT7 5.39e-21 96 27 2 229 3 nodI Nod factor export ATP-binding protein I Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q39GT7 5.71e-18 87 28 4 217 3 nodI Nod factor export ATP-binding protein I Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q47RE8 5.54e-21 97 31 3 207 3 metN Methionine import ATP-binding protein MetN Thermobifida fusca (strain YX)
Q47RE8 3.95e-10 64 27 8 227 3 metN Methionine import ATP-binding protein MetN Thermobifida fusca (strain YX)
Q8UA73 5.56e-21 97 28 4 217 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8UA73 5.97e-15 79 24 6 223 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q02QM1 5.79e-21 96 26 7 281 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q02QM1 9.99e-07 53 21 7 229 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q7VM95 5.85e-21 97 29 4 232 3 metN Methionine import ATP-binding protein MetN Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q7VM95 4.17e-15 80 32 6 207 3 metN Methionine import ATP-binding protein MetN Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8NQU4 6.02e-21 95 28 3 225 1 argV Arginine transport ATP-binding protein ArgV Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8NQU4 1.77e-08 58 32 0 78 1 argV Arginine transport ATP-binding protein ArgV Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8FVV5 6.05e-21 97 30 4 225 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella suis biovar 1 (strain 1330)
Q8FVV5 2.57e-11 68 26 5 206 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella suis biovar 1 (strain 1330)
Q1QVQ7 6.38e-21 97 28 4 232 3 metN Methionine import ATP-binding protein MetN Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1QVQ7 2.12e-11 68 27 4 212 3 metN Methionine import ATP-binding protein MetN Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q9L1C3 6.42e-21 97 29 4 221 3 metN Methionine import ATP-binding protein MetN Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9L1C3 1.83e-14 78 31 11 254 3 metN Methionine import ATP-binding protein MetN Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
O66646 6.75e-21 94 29 3 225 1 lolD Lipoprotein-releasing system ATP-binding protein LolD Aquifex aeolicus (strain VF5)
O66646 3.72e-09 60 38 1 83 1 lolD Lipoprotein-releasing system ATP-binding protein LolD Aquifex aeolicus (strain VF5)
Q8ELA5 6.77e-21 97 30 5 234 3 metN4 Methionine import ATP-binding protein MetN 4 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8ELA5 1.74e-12 72 28 5 206 3 metN4 Methionine import ATP-binding protein MetN 4 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q110U3 6.77e-21 97 31 5 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichodesmium erythraeum (strain IMS101)
Q110U3 1.53e-12 72 24 5 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichodesmium erythraeum (strain IMS101)
Q03A07 7.16e-21 97 31 5 226 3 metN Methionine import ATP-binding protein MetN Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q03A07 2.3e-15 80 29 6 216 3 metN Methionine import ATP-binding protein MetN Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q7UC29 7.24e-21 97 27 2 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Shigella flexneri
Q7UC29 2.42e-15 80 25 7 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Shigella flexneri
Q93DA2 7.4e-21 97 28 10 286 3 metN Methionine import ATP-binding protein MetN Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q93DA2 9.12e-14 76 27 6 222 3 metN Methionine import ATP-binding protein MetN Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q5E715 7.48e-21 97 28 5 232 3 metN Methionine import ATP-binding protein MetN Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q5E715 3.89e-10 65 27 8 220 3 metN Methionine import ATP-binding protein MetN Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q67JX4 7.68e-21 95 31 4 212 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q67JX4 1.27e-11 68 27 5 206 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q8FFB3 7.8e-21 97 27 2 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FFB3 1.3e-15 82 25 7 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P16676 8.57e-21 97 27 2 214 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli (strain K12)
P16676 1.57e-15 81 25 7 231 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli (strain K12)
Q8XBJ8 8.99e-21 97 27 2 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O157:H7
Q8XBJ8 1.46e-15 81 25 7 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_15975
Feature type CDS
Gene rbsA
Product ribose ABC transporter ATP-binding protein RbsA
Location 6426 - 7931 (strand: -1)
Length 1506 (nucleotides) / 501 (amino acids)

Contig

Accession ZDB_696
Length 80662 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_16
Orthogroup size 19
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1129 Carbohydrate transport and metabolism (G) G ABC-type sugar transport system, ATPase component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K10441 ribose transport system ATP-binding protein [EC:7.5.2.7] ABC transporters -

Protein Sequence

MEPLLELKGIDKAFPGVKALSGAALRVYPGRVMALVGENGAGKSTMMKVLTGIYKKDAGQILFLGQERQFTGPKSSQEAGIGIIHQELNLIPELTIAENIFLGREFTGRFGNIDWKKMYAEADKLLARLNLTYSSHRLVAELSIGDQQMVEIAKVLSFESKVIIMDEPTDALTDTETESLFSVIRELREQGCGIVYISHRLKEIFEICDDVTVFRDGQFIGEKPVSDLTEDSLIEMMVGRKLEDQYPRLTLPRGKEKLVVKNLCGRDVHDVSFTLHENEILGVSGLMGAGRTELMKIIYGAMAKTGGTVEMDGKACQINSPKAGLDNGIVYISEDRKRDGLVLGMSVKENMSLTALPYFSSKTGRLNHKEEHLTVSDFIQLFNIKTPGMDQIIGFLSGGNQQKVAIARGLMTRPKVLILDEPTRGVDVGAKKEIYQLINKFKQEGLSIILISSEMPEVMGMSDRILVMHEGRISGEFAAENVTQEALMAAAVGKQYGAGQE

Flanking regions ( +/- flanking 50bp)

ACCATTTGCCAATGTGATGCTGTTCTCCGGCGTGACATTCTGAGGTGTTTATGGAACCGTTACTTGAACTCAAAGGTATCGATAAAGCTTTCCCGGGTGTGAAAGCCTTATCCGGTGCTGCCCTGCGGGTTTATCCCGGCAGAGTGATGGCGCTGGTCGGAGAGAACGGCGCCGGTAAATCCACCATGATGAAAGTGCTGACCGGGATCTACAAAAAAGATGCCGGTCAGATTCTGTTTCTGGGGCAGGAGCGTCAGTTTACGGGGCCGAAATCGTCTCAGGAAGCCGGTATCGGGATTATTCATCAGGAACTGAACCTGATCCCGGAACTGACGATTGCAGAAAACATTTTCCTCGGCCGCGAGTTTACCGGCCGTTTCGGTAACATTGACTGGAAAAAAATGTATGCCGAAGCGGATAAATTACTGGCCCGTCTGAATCTCACTTACAGCAGCCACCGGCTGGTGGCTGAATTGTCTATCGGCGATCAGCAGATGGTGGAAATCGCCAAGGTGCTCAGTTTTGAGTCAAAAGTCATCATTATGGATGAACCGACAGATGCCCTGACAGACACCGAAACCGAATCCCTCTTCAGTGTGATCCGCGAACTGCGCGAGCAGGGCTGCGGGATTGTCTATATATCCCACCGTCTGAAAGAGATTTTTGAGATTTGTGATGATGTGACGGTGTTCCGCGACGGACAGTTTATCGGTGAAAAACCGGTGTCTGACCTGACGGAGGATAGCCTGATCGAAATGATGGTCGGGCGTAAACTGGAAGATCAGTATCCGCGTCTGACTCTGCCGCGCGGCAAAGAGAAGCTGGTGGTAAAAAACCTGTGCGGCCGCGATGTGCATGATGTCAGTTTCACGCTGCATGAGAATGAAATTCTCGGTGTTTCCGGGCTGATGGGCGCCGGGCGTACCGAACTGATGAAAATCATTTACGGTGCGATGGCAAAAACCGGCGGAACGGTTGAAATGGACGGTAAAGCCTGCCAGATAAACTCACCGAAAGCCGGGCTGGATAACGGCATCGTGTATATCTCCGAAGACCGCAAACGCGATGGTCTGGTGCTGGGGATGTCAGTAAAAGAGAACATGTCTCTGACGGCGCTGCCGTATTTCAGCAGCAAGACCGGACGCCTTAATCATAAAGAAGAGCATCTGACTGTCAGCGATTTTATTCAGCTGTTCAATATCAAAACCCCGGGCATGGATCAGATAATCGGGTTCTTATCCGGCGGTAATCAGCAGAAAGTGGCAATTGCACGCGGTCTGATGACGCGGCCGAAAGTTCTGATCCTCGATGAACCGACACGCGGTGTGGATGTCGGGGCGAAGAAAGAGATTTATCAGCTGATCAACAAATTTAAACAGGAAGGCCTGAGTATCATCCTTATTTCATCGGAAATGCCGGAAGTAATGGGGATGAGTGACCGGATTCTGGTCATGCACGAAGGACGGATAAGCGGGGAGTTTGCCGCGGAAAACGTCACTCAGGAAGCATTAATGGCCGCCGCAGTTGGCAAACAATATGGCGCAGGGCAGGAGTAAGATATGCGTACAGATTCAACCCCGGCGTCAAAACGCTGGTTTTCCAAAGA