Homologs in group_21

Help

18 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08075 FBDBKF_08075 33.3 Morganella morganii S1 dmsB DMSO/selenate family reductase complex B subunit
FBDBKF_10455 FBDBKF_10455 32.4 Morganella morganii S1 dmsB DMSO/selenate family reductase complex B subunit
EHELCC_13905 EHELCC_13905 33.3 Morganella morganii S2 dmsB DMSO/selenate family reductase complex B subunit
EHELCC_14790 EHELCC_14790 32.4 Morganella morganii S2 dmsB DMSO/selenate family reductase complex B subunit
NLDBIP_14350 NLDBIP_14350 33.3 Morganella morganii S4 dmsB DMSO/selenate family reductase complex B subunit
NLDBIP_14620 NLDBIP_14620 32.4 Morganella morganii S4 dmsB DMSO/selenate family reductase complex B subunit
LHKJJB_08500 LHKJJB_08500 33.3 Morganella morganii S3 dmsB DMSO/selenate family reductase complex B subunit
LHKJJB_14725 LHKJJB_14725 32.4 Morganella morganii S3 dmsB DMSO/selenate family reductase complex B subunit
HKOGLL_08050 HKOGLL_08050 33.3 Morganella morganii S5 dmsB DMSO/selenate family reductase complex B subunit
HKOGLL_13345 HKOGLL_13345 32.4 Morganella morganii S5 dmsB DMSO/selenate family reductase complex B subunit
F4V73_RS05065 F4V73_RS05065 30.2 Morganella psychrotolerans - DMSO/selenate family reductase complex B subunit
F4V73_RS12920 F4V73_RS12920 33.3 Morganella psychrotolerans - DMSO/selenate family reductase complex B subunit
F4V73_RS14155 F4V73_RS14155 32.4 Morganella psychrotolerans - DMSO/selenate family reductase complex B subunit
PMI_RS00325 PMI_RS00325 32.9 Proteus mirabilis HI4320 - 4Fe-4S dicluster domain-containing protein
PMI_RS00820 PMI_RS00820 33.1 Proteus mirabilis HI4320 - 4Fe-4S dicluster domain-containing protein
PMI_RS05815 PMI_RS05815 28.9 Proteus mirabilis HI4320 dmsB dimethylsulfoxide reductase subunit B
PMI_RS08350 PMI_RS08350 29.7 Proteus mirabilis HI4320 dmsB dimethylsulfoxide reductase subunit B
PMI_RS14660 PMI_RS14660 32.1 Proteus mirabilis HI4320 dmsB dimethylsulfoxide reductase subunit B

Distribution of the homologs in the orthogroup group_21

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_21

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AAL8 2.21e-108 312 78 0 203 4 ydhY Uncharacterized ferredoxin-like protein YdhY Shigella flexneri
P0AAL6 2.21e-108 312 78 0 203 2 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli (strain K12)
P0AAL7 2.21e-108 312 78 0 203 4 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli O157:H7
P0A1I1 4.61e-21 89 32 4 163 1 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1I2 4.61e-21 89 32 4 163 3 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhi
Q7CQM9 1.05e-17 81 28 4 178 1 ttrB Tetrathionate reductase subunit B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O30080 1.46e-17 80 31 4 154 3 ttrB Tetrathionate reductase subunit B Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q8X616 4.11e-15 74 31 5 151 3 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli O157:H7
P77375 5.11e-15 73 31 5 151 2 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli (strain K12)
P31076 1.12e-14 72 31 5 148 4 psrB Polysulfide reductase chain B Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q46819 4.41e-14 70 28 5 163 4 ygfS Putative electron transport protein YgfS Escherichia coli (strain K12)
P0AAJ7 1.21e-13 71 26 5 188 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Shigella flexneri
P0AAJ5 1.21e-13 71 26 5 188 1 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli (strain K12)
P0AAJ6 1.21e-13 71 26 5 188 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8L3A9 1.29e-12 69 31 3 149 1 padI NADH-dependent phenylglyoxylate dehydrogenase subunit beta Aromatoleum evansii
P0AAJ1 1.7e-12 67 30 6 163 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli (strain K12)
P0AAJ2 1.7e-12 67 30 6 163 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
D3RNN7 1.95e-12 67 30 4 142 1 soeB Sulfite dehydrogenase subunit B Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
P18776 2.01e-12 66 30 5 163 1 dmsB Anaerobic dimethyl sulfoxide reductase chain B Escherichia coli (strain K12)
P56256 2.05e-12 65 32 7 162 4 ysaA Putative electron transport protein YsaA Escherichia coli (strain K12)
Q9HR73 4.87e-12 66 31 3 118 2 dmsB Putative dimethyl sulfoxide reductase iron-sulfur subunit B Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
P0AAK4 7.41e-12 64 30 8 171 3 hydN Electron transport protein HydN Escherichia coli (strain K12)
P0AAK5 7.41e-12 64 30 8 171 3 hydN Electron transport protein HydN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAK6 7.41e-12 64 30 8 171 3 hydN Electron transport protein HydN Escherichia coli O157:H7
Q83RZ7 8.01e-12 65 29 5 163 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Shigella flexneri
P0AAJ4 1.12e-11 65 26 2 154 3 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Shigella flexneri
P0AAJ3 1.12e-11 65 26 2 154 1 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Escherichia coli (strain K12)
P0AAK9 3.6e-11 63 30 4 150 3 nrfC Protein NrfC Shigella flexneri
P0AAK7 3.6e-11 63 30 4 150 3 nrfC Protein NrfC Escherichia coli (strain K12)
P0AAK8 3.6e-11 63 30 4 150 3 nrfC Protein NrfC Escherichia coli O157:H7
P44450 6.44e-11 63 25 4 164 3 fdxH Formate dehydrogenase iron-sulfur subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45015 6.73e-11 62 26 3 160 3 nrfC Protein NrfC homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45003 1.88e-10 61 27 4 158 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q46820 7.2e-10 61 27 5 151 2 uacF Putative oxidoreductase UacF Escherichia coli (strain K12)
Q727P4 1.53e-09 58 25 7 176 1 DVU_2811 Formate dehydrogenase 2 subunit beta (cytochrome c-553) Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q47CW7 2.34e-08 56 28 1 107 1 pcrB Perchlorate reductase subunit beta Dechloromonas aromatica (strain RCB)
P37127 2.47e-08 56 27 7 159 2 aegA Putative oxidoreductase AegA Escherichia coli (strain K12)
I3R9M8 3.99e-08 55 34 1 84 1 narH Respiratory nitrate reductase subunit beta Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
Q9S1G9 4.81e-08 55 37 0 81 1 serB Selenate reductase subunit beta Thauera selenatis
P60069 7.39e-08 55 40 0 66 1 clrB Chlorate reductase subunit beta Ideonella dechloratans
Q8GPG3 1.64e-07 53 34 1 84 1 ddhB Dimethylsulfide dehydrogenase subunit beta Rhodovulum sulfidophilum
Q72E85 1.86e-07 53 30 2 115 1 qrcC Menaquinone reductase, iron-sulfur cluster-binding subunit Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P20925 3.26e-07 51 33 4 105 4 None Frd operon probable iron-sulfur subunit A (Fragment) Proteus vulgaris
Q7WTT9 3.42e-07 52 27 3 119 1 arrB Arsenate respiratory reductase iron-sulfur subunit ArrB Shewanella sp. (strain ANA-3)
P27273 4.42e-07 52 31 4 118 1 fdhB1 Formate dehydrogenase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
P42176 4.81e-07 52 37 0 64 3 narH Nitrate reductase beta chain Bacillus subtilis (strain 168)
Q83RN5 5.22e-07 52 26 4 166 3 narH Respiratory nitrate reductase 1 beta chain Shigella flexneri
P11349 5.32e-07 52 26 4 166 1 narH Respiratory nitrate reductase 1 beta chain Escherichia coli (strain K12)
P0AAK0 1.01e-06 51 23 5 166 3 hybA Hydrogenase-2 operon protein HybA Shigella flexneri
P0AAJ8 1.01e-06 51 23 5 166 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli (strain K12)
P0AAJ9 1.01e-06 51 23 5 166 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli O157:H7
P31894 1.07e-06 50 24 5 165 1 cooF Iron-sulfur protein Rhodospirillum rubrum
P19318 1.84e-06 51 28 3 112 1 narY Respiratory nitrate reductase 2 beta chain Escherichia coli (strain K12)
Q8GC87 2.8e-06 49 24 8 170 1 fdhB Formate dehydrogenase subunit beta Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759)
Q57934 2.93e-06 50 25 5 173 4 MJ0514 Uncharacterized polyferredoxin-like protein MJ0514 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q58699 3.93e-06 50 41 4 85 4 MJ1303 Uncharacterized polyferredoxin-like protein MJ1303 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q57619 4.25e-06 48 27 7 153 3 MJ0155 Uncharacterized ferredoxin MJ0155 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q57713 6.28e-06 48 25 5 153 3 MJ0265 Uncharacterized ferredoxin MJ0265 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q00388 1.13e-05 48 27 8 164 4 vhuB Polyferredoxin protein VhuB Methanococcus voltae
Q8TYP4 1.56e-05 48 29 2 91 3 hdrA1 CoB--CoM heterodisulfide reductase iron-sulfur subunit A 1 Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
A2BUD6 2.01e-05 47 30 3 116 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Prochlorococcus marinus (strain MIT 9515)
Q58566 4.68e-05 46 24 7 163 4 fwdF Polyferredoxin protein FwdF Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q31D22 7.05e-05 45 29 3 116 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Prochlorococcus marinus (strain MIT 9312)
A2BNV4 7.61e-05 45 29 3 116 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Prochlorococcus marinus (strain AS9601)
A8G2G5 7.83e-05 45 29 3 116 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Prochlorococcus marinus (strain MIT 9215)
P00202 0.000152 42 41 1 56 1 None Ferredoxin Methanosarcina barkeri
A3PAM7 0.000211 44 28 3 116 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Prochlorococcus marinus (strain MIT 9301)
P60200 0.000232 45 29 2 94 3 hdrA CoB--CoM heterodisulfide reductase iron-sulfur subunit A Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A1KRT1 0.000376 43 34 2 64 3 nuoI NADH-quinone oxidoreductase subunit I Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q7DDS1 0.000376 43 34 2 64 3 nuoI NADH-quinone oxidoreductase subunit I Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JQM2 0.000376 43 34 2 64 3 nuoI NADH-quinone oxidoreductase subunit I Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5F623 0.000376 43 34 2 64 3 nuoI NADH-quinone oxidoreductase subunit I Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q7TUH1 0.00046 43 28 3 116 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
P16432 0.000473 42 32 2 82 1 hycF Formate hydrogenlyase subunit 6 Escherichia coli (strain K12)
Q7VE31 0.000492 43 26 4 134 3 ndhI NAD(P)H-quinone oxidoreductase subunit I Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q57712 0.000602 42 25 5 157 3 MJ0264 Uncharacterized protein MJ0264 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q7NZH3 0.00065 42 32 2 64 3 nuoI NADH-quinone oxidoreductase subunit I Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q6LWL2 0.000836 43 26 1 91 1 hdrA H(2)/formate:CoB-CoM heterodisulfide,ferredoxin reductase subunit A Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q127Y0 0.000873 42 32 2 64 3 nuoI NADH-quinone oxidoreductase subunit I Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q58593 0.001 43 24 7 163 4 vhuB Polyferredoxin protein VhuB Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8M9T7 0.001 42 29 5 124 3 ndhI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic Chaetosphaeridium globosum

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00340
Feature type CDS
Gene -
Product ferredoxin-like protein
Location 98095 - 98724 (strand: -1)
Length 630 (nucleotides) / 209 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_21
Orthogroup size 19
N. genomes 7

Actions

Genomic region

Domains

PF12800 4Fe-4S binding domain
PF13247 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0437 Energy production and conversion (C) C Fe-S-cluster-containing dehydrogenase component (DMSO reductase)

Protein Sequence

MSDTHHRPILDIGLSRLEFLRISGKGLAGITIAPALLSLLGCKQEEIDSGVIQLTTTPKGVLVTNRARCTGCHRCETACTTWNDGSVGSFFSRTKIHRHFYFGDKGIGSGGGLYGDLNFTTDTCRQCKTPECMNVCPVKAIRYQEEFGCIVVDTRRCIGCAACTTACPWMMATVNPQTKKSGKCNLCGECASACPTGALHIIEWKEITV

Flanking regions ( +/- flanking 50bp)

TCATCACAAATTATTTCTTATTTAAATTAGTTAAGCGGAGATAAATATTAATGTCTGATACACATCATCGTCCTATATTAGATATTGGACTATCAAGACTAGAGTTTCTGCGAATATCCGGTAAAGGGCTGGCAGGGATCACCATAGCACCCGCACTACTTTCTCTTTTAGGTTGTAAGCAAGAAGAAATAGACAGTGGCGTTATTCAACTGACAACCACACCTAAAGGTGTATTAGTGACTAATCGTGCCCGTTGCACTGGCTGTCATCGTTGTGAAACAGCATGTACAACATGGAATGATGGTAGCGTTGGATCTTTCTTCTCCCGTACTAAAATCCATCGTCATTTCTATTTTGGTGATAAAGGCATTGGCTCTGGAGGGGGCTTATATGGCGACTTAAACTTTACCACTGATACTTGTCGCCAATGCAAAACACCCGAGTGTATGAACGTCTGCCCAGTAAAAGCTATCCGTTATCAAGAAGAGTTTGGCTGTATTGTCGTTGATACTCGTCGTTGTATCGGCTGTGCCGCTTGTACAACAGCTTGCCCGTGGATGATGGCAACCGTCAATCCACAAACGAAAAAATCCGGTAAATGTAATTTATGTGGTGAATGCGCTTCAGCATGCCCAACAGGGGCATTGCACATTATTGAATGGAAAGAAATTACCGTTTGATTTTTCTTAGCAATCACCTCATTGACCCCTCTTTAGATTAGGAAGCAATA