Homologs in group_1187

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06425 FBDBKF_06425 79.9 Morganella morganii S1 carA carbamoyl phosphate synthase small subunit
EHELCC_09470 EHELCC_09470 79.9 Morganella morganii S2 carA carbamoyl phosphate synthase small subunit
NLDBIP_09850 NLDBIP_09850 79.9 Morganella morganii S4 carA carbamoyl phosphate synthase small subunit
LHKJJB_07905 LHKJJB_07905 79.9 Morganella morganii S3 carA carbamoyl phosphate synthase small subunit
HKOGLL_07455 HKOGLL_07455 79.9 Morganella morganii S5 carA carbamoyl phosphate synthase small subunit
F4V73_RS15500 F4V73_RS15500 80.2 Morganella psychrotolerans carA glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit

Distribution of the homologs in the orthogroup group_1187

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1187

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P14845 0.0 671 83 0 380 3 carA Carbamoyl phosphate synthase small chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z9L8 0.0 664 81 0 382 3 carA Carbamoyl phosphate synthase small chain Salmonella typhi
Q6D0C8 0.0 662 82 0 380 3 carA Carbamoyl phosphate synthase small chain Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8FLB1 0.0 662 81 0 379 3 carA Carbamoyl phosphate synthase small chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A6F1 0.0 662 81 0 379 1 carA Carbamoyl phosphate synthase small chain Escherichia coli (strain K12)
P0A6F2 0.0 662 81 0 379 3 carA Carbamoyl phosphate synthase small chain Escherichia coli O157:H7
Q66ER8 0.0 660 84 0 378 3 carA Carbamoyl phosphate synthase small chain Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZIL5 0.0 660 84 0 378 3 carA Carbamoyl phosphate synthase small chain Yersinia pestis
Q7N8W2 0.0 654 81 0 379 3 carA Carbamoyl phosphate synthase small chain Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9KPH8 0.0 641 79 0 378 3 carA Carbamoyl phosphate synthase small chain Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8DEM1 0.0 635 78 0 377 3 carA Carbamoyl phosphate synthase small chain Vibrio vulnificus (strain CMCP6)
Q7MNU1 0.0 634 78 0 377 3 carA Carbamoyl phosphate synthase small chain Vibrio vulnificus (strain YJ016)
Q87SF4 0.0 629 77 0 377 3 carA Carbamoyl phosphate synthase small chain Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6LUK6 0.0 629 78 0 375 3 carA Carbamoyl phosphate synthase small chain Photobacterium profundum (strain SS9)
Q8EHS6 0.0 597 73 0 382 3 carA Carbamoyl phosphate synthase small chain Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P38098 0.0 561 70 2 382 3 carA Carbamoyl phosphate synthase small chain Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B8GNX4 0.0 558 71 3 372 3 carA Carbamoyl phosphate synthase small chain Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
C5BQ30 0.0 554 70 3 373 3 carA Carbamoyl phosphate synthase small chain Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q8RSS4 0.0 552 69 2 382 3 carA Carbamoyl phosphate synthase small chain Halomonas eurihalina
Q6F8M7 0.0 548 68 3 383 3 carA Carbamoyl phosphate synthase small chain Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q88DU5 0.0 546 68 0 378 3 carA Carbamoyl phosphate synthase small chain Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P57245 0.0 541 66 0 379 3 carA Carbamoyl phosphate synthase small chain Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P38099 0.0 541 70 2 371 3 carA Carbamoyl phosphate synthase small chain Stutzerimonas stutzeri
Q87WP3 0.0 539 67 0 378 3 carA Carbamoyl phosphate synthase small chain Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8K9Z6 0.0 524 64 0 374 3 carA Carbamoyl phosphate synthase small chain Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9CKV3 0.0 516 65 4 386 3 carA Carbamoyl phosphate synthase small chain Pasteurella multocida (strain Pm70)
Q9JVZ6 0.0 513 66 2 372 3 carA Carbamoyl phosphate synthase small chain Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q8XZ85 0.0 512 65 2 375 3 carA Carbamoyl phosphate synthase small chain Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q9JXX4 0.0 511 66 2 372 3 carA Carbamoyl phosphate synthase small chain Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P58895 2.02e-179 507 62 2 388 3 carA Carbamoyl phosphate synthase small chain Xanthomonas axonopodis pv. citri (strain 306)
Q50983 4.69e-179 505 64 2 380 3 carA Carbamoyl phosphate synthase small chain Neisseria gonorrhoeae
P58896 1.47e-178 504 64 2 371 3 carA Carbamoyl phosphate synthase small chain Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
A4SXM1 2.44e-177 502 63 3 384 3 carA Carbamoyl phosphate synthase small chain Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q7VP66 1.4e-174 494 62 5 389 3 carA Carbamoyl phosphate synthase small chain Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B1XUM3 3.1e-173 491 62 4 382 3 carA Carbamoyl phosphate synthase small chain Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q9JP87 7.94e-172 487 63 4 382 3 carA Carbamoyl phosphate synthase small chain Rubrivivax gelatinosus (strain NBRC 100245 / IL144)
Q9PEC2 1.07e-171 486 62 2 374 3 carA Carbamoyl phosphate synthase small chain Xylella fastidiosa (strain 9a5c)
Q87EB9 2.57e-171 486 62 2 374 3 carA Carbamoyl phosphate synthase small chain Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P59576 4.74e-159 455 56 1 374 3 carA Carbamoyl phosphate synthase small chain Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8D3H7 7.43e-141 408 50 2 381 3 carA Carbamoyl phosphate synthase small chain Wigglesworthia glossinidia brevipalpis
Q3A450 8.09e-138 400 54 4 377 3 carA Carbamoyl phosphate synthase small chain Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q7UGJ6 8.32e-133 388 53 4 379 3 carA Carbamoyl phosphate synthase small chain Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A1UTE8 3.42e-132 387 52 5 382 3 carA Carbamoyl phosphate synthase small chain Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
O50235 1.75e-131 384 52 4 375 3 carA Carbamoyl phosphate synthase small chain Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q5LTN6 1.26e-130 383 51 6 386 3 carA Carbamoyl phosphate synthase small chain Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q6YV23 2.59e-128 379 51 5 380 2 CARA Carbamoyl phosphate synthase small chain, chloroplastic Oryza sativa subsp. japonica
Q92N95 4.57e-128 377 53 5 383 3 carA Carbamoyl phosphate synthase small chain Rhizobium meliloti (strain 1021)
Q98IA7 2.67e-127 375 53 4 386 3 carA Carbamoyl phosphate synthase small chain Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B4S5S1 2.88e-127 374 49 3 382 3 carA Carbamoyl phosphate synthase small chain Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A6WZJ5 4.09e-127 374 51 4 383 3 carA Carbamoyl phosphate synthase small chain Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A9IWF8 6.8e-127 374 51 7 384 3 carA Carbamoyl phosphate synthase small chain Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q31LB7 8.8e-127 373 52 5 376 3 carA Carbamoyl phosphate synthase small chain Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P74587 3.81e-126 371 50 4 379 3 carA Carbamoyl phosphate synthase small chain Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8KGA2 6.98e-126 370 50 3 377 3 carA Carbamoyl phosphate synthase small chain Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q5N0L0 1.25e-125 370 52 5 376 3 carA Carbamoyl phosphate synthase small chain Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q6FZ66 1.43e-125 370 49 5 383 3 carA Carbamoyl phosphate synthase small chain Bartonella quintana (strain Toulouse)
B0CHS0 1.81e-125 370 51 5 385 3 carA Carbamoyl phosphate synthase small chain Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8FZJ8 2.04e-125 370 51 5 385 3 carA Carbamoyl phosphate synthase small chain Brucella suis biovar 1 (strain 1330)
A9M6F1 2.04e-125 370 51 5 385 3 carA Carbamoyl phosphate synthase small chain Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q89DR8 2.84e-125 369 51 4 382 3 carA Carbamoyl phosphate synthase small chain Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A5VRM1 9.45e-125 369 51 5 385 3 carA Carbamoyl phosphate synthase small chain Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YIB8 9.45e-125 369 51 5 385 3 carA Carbamoyl phosphate synthase small chain Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0REC2 9.45e-125 369 51 5 385 3 carA Carbamoyl phosphate synthase small chain Brucella melitensis biotype 2 (strain ATCC 23457)
Q57C28 9.45e-125 369 51 5 385 3 carA Carbamoyl phosphate synthase small chain Brucella abortus biovar 1 (strain 9-941)
Q2YM22 9.45e-125 369 51 5 385 3 carA Carbamoyl phosphate synthase small chain Brucella abortus (strain 2308)
B2S6U9 9.45e-125 369 51 5 385 3 carA Carbamoyl phosphate synthase small chain Brucella abortus (strain S19)
Q8DKU5 9.66e-125 367 51 6 384 3 carA Carbamoyl phosphate synthase small chain Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q6G5M0 5.71e-123 363 48 5 383 3 carA Carbamoyl phosphate synthase small chain Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q9LVW7 3.95e-122 363 48 4 380 1 CARA Carbamoyl phosphate synthase small chain, chloroplastic Arabidopsis thaliana
P51201 1.09e-121 360 49 7 387 3 carA Carbamoyl phosphate synthase small chain Porphyra purpurea
Q8UDF7 6.86e-121 358 50 5 383 3 carA Carbamoyl phosphate synthase small chain Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9A4J7 8.05e-121 358 50 5 383 3 carA Carbamoyl phosphate synthase small chain Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
O66727 9.88e-120 354 47 3 373 3 carA Carbamoyl phosphate synthase small chain Aquifex aeolicus (strain VF5)
Q8YXQ7 4.05e-119 353 49 3 376 3 carA Carbamoyl phosphate synthase small chain Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8F6R2 5.78e-115 342 46 4 375 3 carA Carbamoyl phosphate synthase small chain Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q04ZG6 1.64e-114 341 47 5 378 3 carA Carbamoyl phosphate synthase small chain Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04R57 1.64e-114 341 47 5 378 3 carA Carbamoyl phosphate synthase small chain Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q72PK5 2.74e-114 340 46 5 379 3 carA Carbamoyl phosphate synthase small chain Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q1XDT6 3.74e-113 338 47 6 383 3 carA Carbamoyl phosphate synthase small chain Neopyropia yezoensis
B2URJ0 1.05e-112 337 47 5 379 3 carA Carbamoyl phosphate synthase small chain Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
Q0AMR3 4.86e-111 333 48 7 373 3 carA Carbamoyl phosphate synthase small chain Maricaulis maris (strain MCS10)
Q7U7F9 1.81e-110 331 46 6 378 3 carA Carbamoyl phosphate synthase small chain Parasynechococcus marenigrum (strain WH8102)
C6C0A9 4.33e-110 330 46 4 371 3 carA Carbamoyl phosphate synthase small chain Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q4L5Q4 8.99e-109 326 44 6 385 3 carA Carbamoyl phosphate synthase small chain Staphylococcus haemolyticus (strain JCSC1435)
Q9RWI4 1.78e-108 327 45 6 388 3 carA Carbamoyl phosphate synthase small chain Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q1IWN0 1.82e-108 327 45 6 388 3 carA Carbamoyl phosphate synthase small chain Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q5HPY9 2.39e-108 325 43 6 385 3 carA Carbamoyl phosphate synthase small chain Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q6B940 2.47e-108 326 44 5 378 3 carA Carbamoyl phosphate synthase small chain Gracilaria tenuistipitata var. liui
P52557 4.49e-108 324 47 7 375 3 carA Carbamoyl phosphate synthase small chain Bacillus caldolyticus
Q9K9V8 6.36e-108 324 46 6 379 3 pyrAA Carbamoyl phosphate synthase pyrimidine-specific small chain Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8CPJ5 1.48e-107 323 43 6 385 3 carA Carbamoyl phosphate synthase small chain Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5SLL3 1.6e-107 324 44 6 385 3 carA Carbamoyl phosphate synthase small chain Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72GZ0 1.6e-107 324 44 6 385 3 carA Carbamoyl phosphate synthase small chain Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q0BY73 2.8e-107 323 47 5 380 3 carA Carbamoyl phosphate synthase small chain Hyphomonas neptunium (strain ATCC 15444)
C4XRH8 7.55e-107 322 45 4 374 3 carA Carbamoyl phosphate synthase small chain Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q9WZ28 8.62e-107 322 44 6 414 3 carA Carbamoyl phosphate synthase small chain Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q49WY3 9.31e-107 321 44 7 383 3 carA Carbamoyl phosphate synthase small chain Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8CXH8 2.32e-106 320 46 6 378 3 carA Carbamoyl phosphate synthase small chain Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A1VA26 9.8e-106 319 45 6 379 3 carA Carbamoyl phosphate synthase small chain Nitratidesulfovibrio vulgaris (strain DP4)
Q726J4 9.8e-106 319 45 6 379 1 carA Carbamoyl phosphate synthase small chain Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P63730 2.85e-105 317 45 7 384 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain MW2)
Q6GA11 2.85e-105 317 45 7 384 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain MSSA476)
P99147 2.85e-105 317 45 7 384 1 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain N315)
P63729 2.85e-105 317 45 7 384 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGN0 2.85e-105 317 45 7 384 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain COL)
Q6GHN3 4.75e-105 317 45 7 384 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain MRSA252)
P63734 7.67e-105 316 44 5 376 3 carA Carbamoyl phosphate synthase small chain Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P63733 7.67e-105 316 44 5 376 3 carA Carbamoyl phosphate synthase small chain Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8RG87 8.84e-105 316 46 5 372 3 carA Carbamoyl phosphate synthase small chain Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8Y664 1.81e-104 315 46 6 370 3 carA Carbamoyl phosphate synthase small chain Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q92AH2 3.51e-104 315 46 6 370 3 carA Carbamoyl phosphate synthase small chain Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P25993 9.02e-104 313 47 6 378 1 pyrAA Carbamoyl phosphate synthase pyrimidine-specific small chain Bacillus subtilis (strain 168)
Q7VHS5 1.44e-103 313 43 6 378 3 carA Carbamoyl phosphate synthase small chain Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q8KZA0 2.43e-103 313 45 6 375 3 carA Carbamoyl phosphate synthase small chain Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q8XHB2 2.6e-103 311 44 5 369 3 carA Carbamoyl phosphate synthase small chain Clostridium perfringens (strain 13 / Type A)
Q71YI0 2.79e-103 312 46 6 370 3 carA Carbamoyl phosphate synthase small chain Listeria monocytogenes serotype 4b (strain F2365)
A5GTM5 3.32e-103 313 45 7 381 3 carA Carbamoyl phosphate synthase small chain Synechococcus sp. (strain RCC307)
P0DA13 1.64e-102 310 43 6 376 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M3 (strain SSI-1)
Q5XCR8 1.64e-102 310 43 6 376 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DA12 1.64e-102 310 43 6 376 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P63735 1.64e-102 310 43 6 376 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M1
Q6NH15 1.71e-102 311 44 6 388 3 carA Carbamoyl phosphate synthase small chain Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q819S2 5.76e-102 309 47 6 374 3 carA Carbamoyl phosphate synthase small chain Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q827Q8 7.4e-102 309 44 5 381 3 carA Carbamoyl phosphate synthase small chain Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q732I2 7.81e-102 308 47 6 374 3 carA Carbamoyl phosphate synthase small chain Bacillus cereus (strain ATCC 10987 / NRS 248)
P58894 7.91e-102 308 43 6 376 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q636D9 8.7e-102 308 46 6 374 3 carA Carbamoyl phosphate synthase small chain Bacillus cereus (strain ZK / E33L)
P77885 1.27e-101 308 44 5 369 3 pyrAA Carbamoyl phosphate synthase pyrimidine-specific small chain Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q6HES7 1.5e-101 308 46 6 374 3 carA Carbamoyl phosphate synthase small chain Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81WF1 1.5e-101 308 46 6 374 3 carA Carbamoyl phosphate synthase small chain Bacillus anthracis
O28995 2.04e-101 307 43 3 375 3 carA Carbamoyl phosphate synthase small chain Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
B3DQ31 3.25e-100 306 45 5 393 3 carA Carbamoyl phosphate synthase small chain Bifidobacterium longum (strain DJO10A)
P63732 4.21e-100 304 43 5 374 3 carA Carbamoyl phosphate synthase small chain Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P63731 4.21e-100 304 43 5 374 3 carA Carbamoyl phosphate synthase small chain Streptococcus agalactiae serotype III (strain NEM316)
Q67Q55 4.43e-100 304 45 7 375 3 carA Carbamoyl phosphate synthase small chain Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q8FT41 4.7e-100 305 42 7 389 3 carA Carbamoyl phosphate synthase small chain Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q9KXR5 5.14e-100 304 43 5 381 3 carA Carbamoyl phosphate synthase small chain Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q58425 1.55e-99 302 43 5 373 3 carA Carbamoyl phosphate synthase small chain Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q97FT2 1.79e-99 302 42 6 370 3 carA Carbamoyl phosphate synthase small chain Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8G816 1.82e-99 304 44 5 393 3 carA Carbamoyl phosphate synthase small chain Bifidobacterium longum (strain NCC 2705)
Q8DUP4 2.49e-99 302 42 5 374 3 carA Carbamoyl phosphate synthase small chain Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B7GPW1 4.62e-99 303 44 5 393 3 carA Carbamoyl phosphate synthase small chain Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q8TY15 4.82e-99 301 43 5 377 3 carA Carbamoyl phosphate synthase small chain Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q9CF80 7.07e-99 301 43 6 374 3 carA Carbamoyl phosphate synthase small chain Lactococcus lactis subsp. lactis (strain IL1403)
Q9L4N5 1.57e-97 297 42 5 375 3 carA Carbamoyl phosphate synthase small chain Lactococcus lactis subsp. cremoris (strain MG1363)
O19886 2.63e-97 298 42 6 387 3 carA Carbamoyl phosphate synthase small chain Cyanidium caldarium
A4G0Y3 2.19e-95 292 41 5 378 3 carA Carbamoyl phosphate synthase small chain Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
A9A972 3.24e-95 291 41 6 378 3 carA Carbamoyl phosphate synthase small chain Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
A6VHH7 9.36e-95 290 41 5 378 3 carA Carbamoyl phosphate synthase small chain Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
Q8TNY3 1.22e-94 290 43 5 366 3 carA Carbamoyl phosphate synthase small chain Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8Q0U4 2.45e-94 290 43 5 366 3 carA Carbamoyl phosphate synthase small chain Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8RBK1 4.96e-94 288 42 6 376 3 carA Carbamoyl phosphate synthase small chain Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q6LWW5 1.69e-93 287 40 5 378 3 carA Carbamoyl phosphate synthase small chain Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q9PMG8 6.27e-93 286 39 5 376 3 carA Carbamoyl phosphate synthase small chain Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P9WPK5 1.5e-92 285 42 5 382 1 carA Carbamoyl phosphate synthase small chain Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPK4 1.5e-92 285 42 5 382 3 carA Carbamoyl phosphate synthase small chain Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7U055 2.03e-92 285 42 5 382 3 carA Carbamoyl phosphate synthase small chain Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P58893 3.07e-92 285 43 7 384 3 carA Carbamoyl phosphate synthase small chain Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
B8IZS6 4.24e-92 284 43 6 381 3 carA Carbamoyl phosphate synthase small chain Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
A6UQN4 3.07e-91 281 39 6 389 3 carA Carbamoyl phosphate synthase small chain Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q741H2 4.41e-91 281 43 6 388 3 carA Carbamoyl phosphate synthase small chain Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
O27079 1.06e-90 280 42 4 371 3 carA Carbamoyl phosphate synthase small chain Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q1MPN3 6.15e-90 278 43 10 383 3 carA Carbamoyl phosphate synthase small chain Lawsonia intracellularis (strain PHE/MN1-00)
Q17VI1 5.61e-88 273 39 6 378 3 carA Carbamoyl phosphate synthase small chain Helicobacter acinonychis (strain Sheeba)
Q9ZJY9 1.24e-86 270 39 8 379 3 carA Carbamoyl phosphate synthase small chain Helicobacter pylori (strain J99 / ATCC 700824)
Q6C9Y4 3.13e-86 271 40 5 394 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Yarrowia lipolytica (strain CLIB 122 / E 150)
Q9CCR3 1.38e-84 265 40 5 389 3 carA Carbamoyl phosphate synthase small chain Mycobacterium leprae (strain TN)
Q6BJG4 7.02e-84 265 40 6 389 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
O25835 3.16e-83 261 39 8 379 3 carA Carbamoyl phosphate synthase small chain Helicobacter pylori (strain ATCC 700392 / 26695)
Q5AML6 1.77e-82 261 39 6 398 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Candida albicans (strain SC5314 / ATCC MYA-2876)
Q0U5H7 3.74e-81 259 38 7 396 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
Q2H132 6.2e-81 258 39 6 386 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
P07258 3.33e-80 254 40 8 394 1 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q6CIQ1 2.37e-79 252 39 7 381 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
P22572 6.37e-79 253 39 6 384 1 arg-2 Carbamoyl phosphate synthase arginine-specific small chain Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
O60060 1.61e-78 250 39 6 387 3 arg5 Carbamoyl phosphate synthase arginine-specific small chain Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P54324 1.74e-78 248 38 6 374 1 carA Carbamoyl phosphate synthase arginine-specific small chain Geobacillus stearothermophilus
Q9K8V6 6.26e-78 247 39 5 369 3 carA Carbamoyl phosphate synthase arginine-specific small chain Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8U086 1.1e-77 247 37 6 383 3 carA Carbamoyl phosphate synthase small chain Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q6FQ30 1.16e-77 248 38 8 395 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q5BB37 1.67e-77 249 38 5 389 2 cpa-1 Carbamoyl phosphate synthase arginine-specific small chain Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A1CZ92 1.75e-77 249 39 5 386 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
O08317 2.41e-77 245 39 5 372 2 carA Carbamoyl phosphate synthase arginine-specific small chain Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q4WU09 2.66e-77 248 39 5 386 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q1DUF5 4.14e-77 248 38 5 386 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Coccidioides immitis (strain RS)
A1CA18 1.93e-76 246 38 5 388 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
P36838 4.54e-76 242 37 7 376 3 carA Carbamoyl phosphate synthase arginine-specific small chain Bacillus subtilis (strain 168)
A2R9B9 9.42e-76 244 38 5 388 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
Q8ZY49 1.02e-75 241 37 6 370 3 carA Carbamoyl phosphate synthase small chain Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
P87183 1.75e-75 244 39 7 381 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Hypocrea virens
Q2U913 3.46e-75 243 38 5 386 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q752N9 1.17e-70 229 37 9 393 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
O93937 2.1e-70 243 38 7 393 3 pyrABCN Multifunctional protein pyrABCN Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q91437 5.32e-70 242 40 8 382 2 CAD Multifunctional protein CAD Squalus acanthias
Q7S8A6 1.34e-68 238 37 8 402 1 pyr-3 Multifunctional protein pyr-3 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P20054 4.01e-68 236 37 8 387 1 pyr1-3 Multifunctional protein pyr1-3 Dictyostelium discoideum
B2RQC6 1.45e-67 235 39 6 383 1 Cad Multifunctional protein CAD Mus musculus
P08955 4.72e-67 233 38 6 383 1 CAD Multifunctional protein CAD Mesocricetus auratus
Q09794 7.06e-67 233 36 7 395 1 ura1 Multifunctional protein ura1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P27708 1.5e-66 232 38 8 385 1 CAD Multifunctional protein CAD Homo sapiens
P07259 7.88e-66 230 37 7 393 1 URA2 Multifunctional protein URA2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P05990 3.52e-65 228 38 8 389 1 r Multifunctional protein r Drosophila melanogaster
Q18990 4.86e-65 228 36 7 387 1 pyr-1 Multifunctional protein pyr-1 Caenorhabditis elegans
Q59968 6.79e-64 211 33 7 390 3 carA Carbamoyl phosphate synthase small chain Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
A4YI77 4.07e-63 209 32 5 379 3 carA Carbamoyl phosphate synthase small chain Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
Q970U8 4.21e-63 209 33 8 382 3 carA Carbamoyl phosphate synthase small chain Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q9HP42 3.15e-62 206 34 6 375 3 carA Carbamoyl phosphate synthase small chain Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R6F1 3.15e-62 206 34 6 375 3 carA Carbamoyl phosphate synthase small chain Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q91293 3.63e-61 216 35 7 386 2 None Carbamoyl-phosphate synthase [ammonia], mitochondrial Aquarana catesbeiana
Q4J8E9 8.15e-61 203 33 6 379 3 carA Carbamoyl phosphate synthase small chain Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
P31327 2.56e-60 214 35 8 387 1 CPS1 Carbamoyl-phosphate synthase [ammonia], mitochondrial Homo sapiens
Q8C196 5.89e-60 213 35 8 387 1 Cps1 Carbamoyl-phosphate synthase [ammonia], mitochondrial Mus musculus
P07756 1.59e-59 212 34 8 387 1 Cps1 Carbamoyl-phosphate synthase [ammonia], mitochondrial Rattus norvegicus
Q97AJ4 2.61e-55 188 36 12 365 3 carA Carbamoyl phosphate synthase small chain Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q9HK16 1.14e-49 174 33 11 367 3 carA Carbamoyl phosphate synthase small chain Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q08654 2.72e-15 80 31 6 162 3 trpGD Bifunctional protein TrpGD Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9YGB2 2.03e-14 74 34 4 149 3 trpG Anthranilate synthase component 2 Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P00901 4.01e-14 73 31 6 165 1 trpG Anthranilate synthase component 2 Pseudomonas putida
P20576 1.02e-12 70 32 6 146 1 trpG Anthranilate synthase component 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P26922 1.42e-12 69 30 3 146 1 trpG Anthranilate synthase component 2 Azospirillum brasilense
P06194 1.7e-12 68 28 4 160 3 pabA Aminodeoxychorismate synthase component 2 Klebsiella aerogenes
Q57690 2.65e-12 68 27 4 185 3 trpG Anthranilate synthase component 2 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P00937 3.29e-12 71 32 7 163 1 TRP3 Multifunctional tryptophan biosynthesis protein Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P28819 3.41e-12 68 28 5 157 2 pabA Aminodeoxychorismate/anthranilate synthase component 2 Bacillus subtilis (strain 168)
Q8RDR4 1.83e-11 68 31 11 202 3 guaA GMP synthase [glutamine-hydrolyzing] Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
P06195 1.11e-10 63 30 3 135 3 pabA Aminodeoxychorismate synthase component 2 Serratia marcescens
Q06129 1.66e-10 63 28 6 182 1 trpG Anthranilate synthase component 2 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P06193 2.47e-10 62 31 3 133 3 pabA Aminodeoxychorismate synthase component 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q1XDC5 3.25e-10 62 27 4 149 4 trpG Anthranilate synthase component 2 Neopyropia yezoensis
P48261 8.35e-10 61 31 8 161 3 trpG Anthranilate synthase component 2 Cyanophora paradoxa
P51362 9.94e-10 60 30 3 136 4 trpG Anthranilate synthase component 2 Porphyra purpurea
P15395 1.26e-09 63 29 3 151 4 trpE(G) Anthranilate synthase Rhizobium meliloti (strain 1021)
P00902 1.36e-09 60 28 7 181 3 trpG Anthranilate synthase component 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P24773 1.46e-09 63 27 6 192 3 trpC Multifunctional tryptophan biosynthesis protein Penicillium chrysogenum
P05328 1.95e-09 63 31 7 167 3 trpC Multifunctional tryptophan biosynthesis protein Aspergillus niger
P00903 2.77e-09 59 30 4 138 1 pabA Aminodeoxychorismate synthase component 2 Escherichia coli (strain K12)
Q0W700 3.04e-09 59 27 8 184 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
Q5V632 3.66e-09 59 34 5 135 3 trpG2 Anthranilate synthase component II Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q2NER5 4.7e-09 58 25 7 193 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q47LQ0 5.07e-09 61 29 7 186 3 guaA GMP synthase [glutamine-hydrolyzing] Thermobifida fusca (strain YX)
Q8G5P4 9.27e-09 60 27 8 195 3 guaA GMP synthase [glutamine-hydrolyzing] Bifidobacterium longum (strain NCC 2705)
Q83GZ6 1.07e-08 60 32 6 172 3 guaA GMP synthase [glutamine-hydrolyzing] Tropheryma whipplei (strain Twist)
Q8DU81 1.26e-08 60 28 8 215 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B2G994 1.48e-08 60 28 7 174 3 guaA GMP synthase [glutamine-hydrolyzing] Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLY3 1.48e-08 60 28 7 174 3 guaA GMP synthase [glutamine-hydrolyzing] Limosilactobacillus reuteri (strain DSM 20016)
Q764B9 1.5e-08 58 28 6 166 1 ASB2 Anthranilate synthase beta subunit 2, chloroplastic Oryza sativa subsp. japonica
Q8PXF0 1.56e-08 57 29 7 179 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q12UJ5 2.05e-08 57 27 7 181 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q02003 2.74e-08 57 27 7 176 3 trpG Anthranilate synthase component 2 Lactococcus lactis subsp. lactis (strain IL1403)
Q9FJM5 3.17e-08 57 26 7 187 2 ASB2 Anthranilate synthase beta subunit 2, chloroplastic Arabidopsis thaliana
Q83ID3 3.64e-08 58 31 6 172 3 guaA GMP synthase [glutamine-hydrolyzing] Tropheryma whipplei (strain TW08/27)
A4FW79 4.03e-08 56 29 6 145 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Q42565 4.36e-08 57 25 7 205 1 ASB1 Anthranilate synthase beta subunit 1, chloroplastic Arabidopsis thaliana
P06531 5.06e-08 58 27 6 184 2 trpC Multifunctional tryptophan biosynthesis protein Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q979P8 5.36e-08 56 27 9 191 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q7XUS2 6.09e-08 57 27 6 170 1 ASB1 Anthranilate synthase beta subunit 1, chloroplastic Oryza sativa subsp. japonica
P09575 7e-08 57 30 7 163 4 None Multifunctional tryptophan biosynthesis protein (Fragment) Pichia angusta
P00908 9.18e-08 57 30 7 166 3 trp-1 Multifunctional tryptophan biosynthesis protein Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
A6TLR3 9.49e-08 57 27 8 179 3 guaA GMP synthase [glutamine-hydrolyzing] Alkaliphilus metalliredigens (strain QYMF)
P9WN35 1e-07 55 27 2 129 1 trpG Anthranilate synthase component 2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN34 1e-07 55 27 2 129 3 trpG Anthranilate synthase component 2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A6QBI5 1.25e-07 57 30 9 178 3 guaA GMP synthase [glutamine-hydrolyzing] Sulfurovum sp. (strain NBC37-1)
O59071 1.26e-07 55 34 2 82 1 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P05379 1.31e-07 55 31 5 141 3 trpG Anthranilate synthase component 2 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
O28670 1.77e-07 54 29 7 162 3 trpG Anthranilate synthase component 2 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q46E00 1.79e-07 54 26 6 182 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanosarcina barkeri (strain Fusaro / DSM 804)
P18483 1.84e-07 57 29 9 167 3 trpC Multifunctional tryptophan biosynthesis protein Aspergillus awamori
P32483 2.11e-07 56 32 7 152 3 pabAB Aminodeoxychorismate synthase Streptomyces griseus
Q87BK6 2.15e-07 56 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6W2 2.15e-07 56 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Xylella fastidiosa (strain M23)
Q8THC7 2.33e-07 54 37 2 85 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q0IE37 2.37e-07 56 29 8 178 3 guaA GMP synthase [glutamine-hydrolyzing] Synechococcus sp. (strain CC9311)
Q6KZC5 2.55e-07 53 29 9 174 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
A6VH31 3.04e-07 53 28 7 159 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
A9A9L8 3.15e-07 53 27 6 154 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
A7GKG1 3.37e-07 55 26 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B9MS76 3.88e-07 55 30 3 112 3 guaA GMP synthase [glutamine-hydrolyzing] Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
C5CBZ4 4.04e-07 55 28 8 186 3 guaA GMP synthase [glutamine-hydrolyzing] Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
Q9HSH4 4.3e-07 53 28 6 153 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
A5N5D9 4.38e-07 55 23 6 188 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYY7 4.38e-07 55 23 6 188 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium kluyveri (strain NBRC 12016)
B7IUT1 4.43e-07 55 25 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain G9842)
Q8Y822 5.28e-07 55 28 5 173 3 guaA GMP synthase [glutamine-hydrolyzing] Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B2KCS8 6.07e-07 55 25 8 202 3 guaA GMP synthase [glutamine-hydrolyzing] Elusimicrobium minutum (strain Pei191)
Q5JFM4 6.2e-07 52 25 6 177 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q6LXA7 6.41e-07 52 28 7 146 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
A1AXH0 6.43e-07 55 24 7 198 3 guaA GMP synthase [glutamine-hydrolyzing] Ruthia magnifica subsp. Calyptogena magnifica
Q046I2 7.12e-07 54 26 6 173 3 guaA GMP synthase [glutamine-hydrolyzing] Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q720X7 7.61e-07 54 27 5 173 3 guaA GMP synthase [glutamine-hydrolyzing] Listeria monocytogenes serotype 4b (strain F2365)
Q5FMD6 9.94e-07 54 26 7 186 3 guaA GMP synthase [glutamine-hydrolyzing] Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q81IS3 1.01e-06 54 25 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8U0R9 1.09e-06 52 32 2 82 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
A6UQ90 1.23e-06 52 29 7 163 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q9V0I6 1.42e-06 51 33 2 81 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Pyrococcus abyssi (strain GE5 / Orsay)
B7H4Q8 1.45e-06 53 25 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain B4264)
B2UZ05 1.61e-06 53 27 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain Alaska E43 / Type E3)
Q04CA4 1.72e-06 53 31 3 112 3 guaA GMP synthase [glutamine-hydrolyzing] Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBU7 1.72e-06 53 31 3 112 3 guaA GMP synthase [glutamine-hydrolyzing] Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q74LF7 1.77e-06 53 26 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q3SQP4 1.95e-06 53 28 9 195 3 guaA GMP synthase [glutamine-hydrolyzing] Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q2KDG7 2.06e-06 53 27 9 201 3 guaA GMP synthase [glutamine-hydrolyzing] Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A0RQD7 2.11e-06 53 29 7 175 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter fetus subsp. fetus (strain 82-40)
A6SZM5 2.21e-06 53 26 6 188 3 guaA GMP synthase [glutamine-hydrolyzing] Janthinobacterium sp. (strain Marseille)
A8ETA7 2.3e-06 53 27 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Aliarcobacter butzleri (strain RM4018)
Q92CU0 2.34e-06 53 27 5 173 3 guaA GMP synthase [glutamine-hydrolyzing] Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B2J9G3 2.42e-06 53 32 6 127 3 guaA GMP synthase [glutamine-hydrolyzing] Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
P72539 2.57e-06 53 29 7 168 3 papA Aminodeoxychorismate synthase Streptomyces pristinaespiralis
A6Q4N8 2.99e-06 52 28 10 185 3 guaA GMP synthase [glutamine-hydrolyzing] Nitratiruptor sp. (strain SB155-2)
P20441 3.03e-06 51 30 6 150 3 trpG Anthranilate synthase component 2 Leptospira biflexa
B9KFL4 3.28e-06 52 33 4 116 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A5UK20 3.36e-06 50 26 8 171 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
P46810 3.37e-06 52 30 7 186 3 guaA GMP synthase [glutamine-hydrolyzing] Mycobacterium leprae (strain TN)
B8ZUE2 3.37e-06 52 30 7 186 3 guaA GMP synthase [glutamine-hydrolyzing] Mycobacterium leprae (strain Br4923)
A0B5J1 3.38e-06 50 24 8 178 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
Q18KM8 3.5e-06 50 27 7 174 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
A9VQG9 3.55e-06 52 25 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus mycoides (strain KBAB4)
B0U3R8 3.62e-06 52 34 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Xylella fastidiosa (strain M12)
Q8FRZ3 3.66e-06 52 29 9 207 3 guaA GMP synthase [glutamine-hydrolyzing] Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B7K8T7 3.76e-06 52 27 7 173 3 guaA GMP synthase [glutamine-hydrolyzing] Gloeothece citriformis (strain PCC 7424)
B3PYH7 4.13e-06 52 27 9 204 3 guaA GMP synthase [glutamine-hydrolyzing] Rhizobium etli (strain CIAT 652)
Q65MU0 4.39e-06 52 27 9 187 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q73ER7 4.43e-06 52 25 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain ATCC 10987 / NRS 248)
P33974 5.11e-06 50 30 6 143 3 trpG Anthranilate synthase component 2 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
C0R5H8 5.14e-06 52 25 7 193 3 guaA GMP synthase [glutamine-hydrolyzing] Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q73IH1 5.14e-06 52 25 7 193 3 guaA GMP synthase [glutamine-hydrolyzing] Wolbachia pipientis wMel
P29727 5.52e-06 52 28 8 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus subtilis (strain 168)
Q1QKC3 5.58e-06 52 27 11 219 3 guaA GMP synthase [glutamine-hydrolyzing] Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q63GV4 5.94e-06 52 25 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain ZK / E33L)
C1EUB4 5.94e-06 52 25 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain 03BB102)
A0R8W7 5.94e-06 52 25 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus thuringiensis (strain Al Hakam)
C3L508 5.94e-06 52 25 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PBL1 5.94e-06 52 25 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus anthracis (strain A0248)
Q6HPC6 5.99e-06 52 25 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus thuringiensis subsp. konkukian (strain 97-27)
B7JM61 6.13e-06 52 25 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain AH820)
Q81VE0 6.13e-06 52 25 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus anthracis
Q30TH8 6.16e-06 52 27 9 183 3 guaA GMP synthase [glutamine-hydrolyzing] Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
C1CLE8 6.7e-06 51 29 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain P1031)
Q1J0T4 6.82e-06 51 26 7 197 3 guaA GMP synthase [glutamine-hydrolyzing] Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q5M4P4 6.86e-06 51 27 8 181 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M029 7.36e-06 51 27 8 181 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus thermophilus (strain CNRZ 1066)
A4G4U7 8.28e-06 51 26 7 189 3 guaA GMP synthase [glutamine-hydrolyzing] Herminiimonas arsenicoxydans
Q0AW22 8.55e-06 51 27 7 178 3 guaA GMP synthase [glutamine-hydrolyzing] Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A4XKX8 9.1e-06 51 24 6 173 3 guaA GMP synthase [glutamine-hydrolyzing] Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q3ITY2 9.25e-06 49 29 7 162 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
B5ZYE9 9.52e-06 51 27 9 204 3 guaA GMP synthase [glutamine-hydrolyzing] Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B2TIX3 1.01e-05 51 26 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain Eklund 17B / Type B)
P49057 1.13e-05 50 27 9 179 3 guaA GMP synthase [glutamine-hydrolyzing] Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P71381 1.13e-05 49 32 6 134 3 trpG Anthranilate synthase component 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8LPN3 1.25e-05 51 32 3 112 1 ADCS Aminodeoxychorismate synthase, chloroplastic Arabidopsis thaliana
Q891G7 1.27e-05 50 24 8 197 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium tetani (strain Massachusetts / E88)
O26805 1.33e-05 48 26 5 146 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q7M8K2 1.38e-05 50 27 8 173 3 guaA GMP synthase [glutamine-hydrolyzing] Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q5L3E1 1.39e-05 50 30 7 155 3 guaA GMP synthase [glutamine-hydrolyzing] Geobacillus kaustophilus (strain HTA426)
Q8DZX7 1.52e-05 50 25 6 174 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E5M8 1.52e-05 50 25 6 174 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus agalactiae serotype III (strain NEM316)
Q3K1C0 1.52e-05 50 25 6 174 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B9J7L1 1.78e-05 50 27 10 211 3 guaA GMP synthase [glutamine-hydrolyzing] Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
C1CQS0 2.16e-05 50 28 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain Taiwan19F-14)
P64298 2.16e-05 50 28 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P64297 2.16e-05 50 28 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B1ICM9 2.16e-05 50 28 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain Hungary19A-6)
C1C842 2.16e-05 50 28 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain 70585)
B5E5U0 2.16e-05 50 28 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae serotype 19F (strain G54)
Q04JQ8 2.16e-05 50 28 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B2IQR1 2.19e-05 50 28 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain CGSP14)
B6JHM4 2.24e-05 50 27 9 194 3 guaA GMP synthase [glutamine-hydrolyzing] Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q9PAR6 2.36e-05 50 33 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Xylella fastidiosa (strain 9a5c)
Q7VG78 2.37e-05 50 31 3 101 3 guaA Probable GMP synthase [glutamine-hydrolyzing] Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q1MMJ7 2.44e-05 50 26 9 204 3 guaA GMP synthase [glutamine-hydrolyzing] Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A2RED2 2.69e-05 49 27 6 174 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M5 (strain Manfredo)
Q8DGA5 2.75e-05 49 26 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B3CPU7 2.86e-05 49 23 7 197 3 guaA GMP synthase [glutamine-hydrolyzing] Wolbachia pipientis subsp. Culex pipiens (strain wPip)
B3PIG3 2.92e-05 49 24 8 203 3 guaA GMP synthase [glutamine-hydrolyzing] Cellvibrio japonicus (strain Ueda107)
C1CF29 3.01e-05 49 28 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain JJA)
B8ZKZ5 3.01e-05 49 28 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Q5GSJ3 3.06e-05 49 23 7 206 3 guaA GMP synthase [glutamine-hydrolyzing] Wolbachia sp. subsp. Brugia malayi (strain TRS)
A6LKY1 3.12e-05 49 23 7 198 3 guaA GMP synthase [glutamine-hydrolyzing] Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
B7IHI2 3.15e-05 49 34 4 104 3 guaA GMP synthase [glutamine-hydrolyzing] Thermosipho africanus (strain TCF52B)
P60501 3.2e-05 49 27 9 207 3 guaA GMP synthase [glutamine-hydrolyzing] Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q3AD70 3.34e-05 49 25 8 193 3 guaA GMP synthase [glutamine-hydrolyzing] Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
P22101 3.45e-05 47 28 5 144 3 trpG Anthranilate synthase component 2 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7Z235 3.79e-05 49 28 8 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q58970 4.19e-05 47 37 2 80 1 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q212S9 4.3e-05 49 27 9 211 3 guaA GMP synthase [glutamine-hydrolyzing] Rhodopseudomonas palustris (strain BisB18)
B1XLR5 4.55e-05 49 31 2 101 3 guaA GMP synthase [glutamine-hydrolyzing] Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q6ASN4 5.09e-05 48 24 7 175 3 guaA GMP synthase [glutamine-hydrolyzing] Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
O27693 5.51e-05 47 26 6 149 3 trpG Anthranilate synthase component 2 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q9PN49 5.57e-05 48 34 3 88 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q6TAS3 5.69e-05 48 24 6 207 1 ADCS Aminodeoxychorismate synthase, chloroplastic Solanum lycopersicum
A1W0N3 6.13e-05 48 25 8 206 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A2BTY4 6.69e-05 48 26 8 175 3 guaA GMP synthase [glutamine-hydrolyzing] Prochlorococcus marinus (strain MIT 9515)
C4ZCQ4 6.78e-05 48 26 7 175 3 guaA GMP synthase [glutamine-hydrolyzing] Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q8CXK8 6.88e-05 48 27 5 176 3 guaA GMP synthase [glutamine-hydrolyzing] Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q46I26 7.05e-05 48 28 8 181 3 guaA GMP synthase [glutamine-hydrolyzing] Prochlorococcus marinus (strain NATL2A)
A2BZD9 7.36e-05 48 28 9 184 3 guaA GMP synthase [glutamine-hydrolyzing] Prochlorococcus marinus (strain NATL1A)
B8I4P0 7.51e-05 48 25 9 183 3 guaA GMP synthase [glutamine-hydrolyzing] Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q7UFS3 7.64e-05 48 26 8 196 3 guaA GMP synthase [glutamine-hydrolyzing] Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q5HTL3 7.78e-05 48 32 3 88 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter jejuni (strain RM1221)
B1WY30 0.000108 47 27 7 179 3 guaA GMP synthase [glutamine-hydrolyzing] Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q2RGP2 0.000109 47 26 7 163 3 guaA GMP synthase [glutamine-hydrolyzing] Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q9HPG6 0.000115 46 28 6 155 3 trpG Anthranilate synthase component 2 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q31F66 0.000116 47 23 9 184 3 guaA GMP synthase [glutamine-hydrolyzing] Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B3ELI1 0.000117 47 28 10 182 3 guaA GMP synthase [glutamine-hydrolyzing] Chlorobium phaeobacteroides (strain BS1)
A8FAH5 0.000118 47 32 3 97 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus pumilus (strain SAFR-032)
A3PA84 0.000124 47 25 9 181 3 guaA GMP synthase [glutamine-hydrolyzing] Prochlorococcus marinus (strain MIT 9301)
Q5Z856 0.000128 47 35 3 89 2 ADCS Probable aminodeoxychorismate synthase, chloroplastic Oryza sativa subsp. japonica
P26923 0.000128 46 25 5 164 3 trpG Anthranilate synthase component 2 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q311X7 0.00013 47 37 4 89 3 guaA GMP synthase [glutamine-hydrolyzing] Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A7H2D2 0.000136 47 34 3 88 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q73U79 0.000144 47 28 7 191 3 guaA GMP synthase [glutamine-hydrolyzing] Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q5N2F8 0.000153 47 30 2 101 3 guaA GMP synthase [glutamine-hydrolyzing] Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q6G197 0.000161 47 25 8 214 3 guaA GMP synthase [glutamine-hydrolyzing] Bartonella quintana (strain Toulouse)
O19914 0.000164 45 27 4 137 4 trpG Anthranilate synthase component 2 Cyanidium caldarium
A8FMV3 0.000192 47 32 3 88 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q4JTG0 0.000204 47 33 5 116 3 guaA GMP synthase [glutamine-hydrolyzing] Corynebacterium jeikeium (strain K411)
O94277 0.000218 47 28 6 152 3 SPBP8B7.29 Putative aminodeoxychorismate synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q5WJI0 0.000236 47 30 7 156 3 guaA GMP synthase [glutamine-hydrolyzing] Shouchella clausii (strain KSM-K16)
Q8RC63 0.000241 46 24 5 179 3 guaA GMP synthase [glutamine-hydrolyzing] Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P14952 0.000256 43 35 1 57 3 trpG Anthranilate synthase component 2 (Fragment) Acetivibrio thermocellus
Q82HM9 0.000266 46 26 7 191 3 guaA GMP synthase [glutamine-hydrolyzing] Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B9L0W3 0.000269 46 32 4 116 3 guaA GMP synthase [glutamine-hydrolyzing] Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
Q5ZUS0 0.00032 46 22 7 185 3 guaA GMP synthase [glutamine-hydrolyzing] Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q839J8 0.000322 46 31 3 93 3 guaA GMP synthase [glutamine-hydrolyzing] Enterococcus faecalis (strain ATCC 700802 / V583)
Q5P9L5 0.000336 46 24 6 197 3 guaA GMP synthase [glutamine-hydrolyzing] Anaplasma marginale (strain St. Maries)
B9KH18 0.000336 46 24 6 197 3 guaA GMP synthase [glutamine-hydrolyzing] Anaplasma marginale (strain Florida)
Q7V3N7 0.000338 46 27 10 179 3 guaA GMP synthase [glutamine-hydrolyzing] Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
O28949 0.000365 44 25 9 196 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A6W2W4 0.000369 46 34 4 100 3 guaA GMP synthase [glutamine-hydrolyzing] Marinomonas sp. (strain MWYL1)
P44339 0.000383 44 26 4 128 4 HI_1171 Putative anthranilate synthase component II Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9RT91 0.000385 46 29 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q88Y74 0.000425 45 25 6 174 3 guaA GMP synthase [glutamine-hydrolyzing] Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B9JZA3 0.000426 45 30 4 108 3 guaA GMP synthase [glutamine-hydrolyzing] Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B2A5V5 0.000457 45 25 7 183 3 guaA GMP synthase [glutamine-hydrolyzing] Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
A2C5P2 0.000472 45 28 10 179 3 guaA GMP synthase [glutamine-hydrolyzing] Prochlorococcus marinus (strain MIT 9303)
Q8XI46 0.000477 45 24 9 184 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium perfringens (strain 13 / Type A)
O25165 0.000485 45 29 5 122 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter pylori (strain ATCC 700392 / 26695)
Q5NN19 0.000501 45 25 7 193 3 guaA GMP synthase [glutamine-hydrolyzing] Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B9DLM7 0.000536 45 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus carnosus (strain TM300)
B4RJH7 0.000564 45 26 7 176 1 guaA GMP synthase [glutamine-hydrolyzing] Neisseria gonorrhoeae (strain NCCP11945)
Q92370 0.000593 45 27 5 147 2 trp1 Multifunctional tryptophan biosynthesis protein Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q3MEA8 0.000614 45 30 4 106 3 guaA GMP synthase [glutamine-hydrolyzing] Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q9L0H2 0.00064 45 26 8 189 3 guaA GMP synthase [glutamine-hydrolyzing] Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
C1D0M2 0.000649 45 30 3 98 3 guaA GMP synthase [glutamine-hydrolyzing] Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
C3MCS5 0.000708 45 25 9 204 3 guaA GMP synthase [glutamine-hydrolyzing] Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A0Q2S8 0.000867 45 29 5 117 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium novyi (strain NT)
P00906 0.000883 43 25 4 144 4 trpG-TRPD Anthranilate synthase component II (Fragment) Shigella dysenteriae
Q8NY69 0.001 45 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain MW2)
Q6GC81 0.001 45 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain MSSA476)
Q6GJQ6 0.001 45 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain MRSA252)
P99105 0.001 45 30 3 102 1 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain N315)
P64296 0.001 45 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IPX0 0.001 45 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain JH9)
A6TYP2 0.001 45 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain JH1)
A7WY93 0.001 45 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain Mu3 / ATCC 700698)
A8Z0R1 0.001 45 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain USA300 / TCH1516)
A6QE71 0.001 45 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain Newman)
Q5HIQ6 0.001 45 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain COL)
Q2G0Y6 0.001 45 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJM5 0.001 45 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Staphylococcus aureus (strain USA300)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00100
Feature type CDS
Gene carA
Product glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit
Location 32136 - 33299 (strand: 1)
Length 1164 (nucleotides) / 387 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1187
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00117 Glutamine amidotransferase class-I
PF00988 Carbamoyl-phosphate synthase small chain, CPSase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0505 Amino acid transport and metabolism (E)
Nucleotide transport and metabolism (F)
EF Carbamoylphosphate synthase small subunit

Kegg Ortholog Annotation(s)

Protein Sequence

MIKSAILVLEDGTEFHGRSIGAEGAAIGEVVFNTSMTGYQEILTDPSYSQQIVTLTYPHIGNTGVNSSDEESATIHAQGLIIRDLPLVMSNYRAEESLADYLKRHQIVAIADIDTRKLTRLLREKGAQNGCIIAGTHLDAKQALEKAKAFPGLKGMDLAKTVTVEQPYQWTQGSWTLKGELPATQSPQDLPLHVVAYDFGVKRNILRMLVDRGCRVTVVPAQTSAQEVLALSPDGIFLSNGPGDPEPCDYAIDAIQTFLTTDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKDLDNNSVMITAQNHGFAVDEASLPDCLRVTHKSLFDGSLQGIHRTDKAAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRQNLQSVTNK

Flanking regions ( +/- flanking 50bp)

ATCTGAATTAATATGCATGAAATGTGATTTATTATTCTCTGGAGGGCGTTTTGATTAAATCAGCTATACTGGTTCTAGAAGATGGGACCGAATTCCACGGCAGGTCGATAGGCGCAGAAGGCGCTGCTATCGGTGAAGTCGTTTTTAATACTTCCATGACCGGTTACCAAGAAATATTAACCGACCCTTCTTACTCCCAACAAATTGTTACTCTCACCTATCCTCATATTGGCAATACCGGCGTTAATTCCTCAGATGAAGAATCAGCAACTATCCATGCTCAAGGGTTAATTATTCGCGATTTACCCCTAGTGATGAGTAATTATCGTGCCGAAGAGAGCTTAGCCGATTACCTTAAACGTCATCAGATTGTGGCGATAGCTGATATTGATACACGTAAATTGACGCGATTATTGAGAGAAAAAGGCGCACAAAACGGTTGTATTATCGCAGGCACTCATCTTGATGCTAAACAAGCGCTTGAAAAAGCAAAAGCGTTTCCAGGATTAAAAGGAATGGATTTGGCGAAAACGGTGACAGTGGAACAACCTTATCAATGGACACAAGGCAGTTGGACATTAAAAGGAGAGTTGCCCGCCACTCAATCACCACAAGATCTCCCTTTACATGTGGTGGCCTATGATTTTGGTGTGAAACGTAATATTTTACGTATGCTGGTGGATAGAGGCTGTCGAGTAACAGTGGTTCCAGCACAAACCTCAGCCCAAGAAGTGTTAGCGCTCTCACCTGATGGCATTTTTCTCTCTAATGGTCCGGGGGATCCAGAGCCCTGTGATTATGCAATTGACGCCATCCAAACTTTCTTAACTACCGATATTCCAGTATTTGGTATCTGCTTAGGGCACCAATTATTAGCCTTGGCGAGTGGTGCAAAAACCGTAAAAATGAAATTTGGTCATCATGGTGGCAACCATCCCGTTAAAGATTTAGATAATAACAGTGTGATGATCACCGCCCAAAACCACGGCTTTGCTGTTGATGAAGCATCGTTACCTGATTGTTTAAGAGTGACACATAAATCACTATTTGATGGTTCTCTACAAGGTATTCATCGCACAGATAAAGCTGCATTTAGTTTCCAAGGTCACCCAGAAGCGAGTCCAGGGCCGCATGATGCGGCGCCGCTTTTTGATCACTTTATTGAACTTATTGAGCAATATCGTCAAAACCTGCAATCAGTGACAAACAAATAAATCAGGAGTGAAAAAAATGGCTAAAAGAACAGATATTAAAACAATCCTGA