Homologs in group_1187

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06425 FBDBKF_06425 93.9 Morganella morganii S1 carA carbamoyl phosphate synthase small subunit
EHELCC_09470 EHELCC_09470 93.9 Morganella morganii S2 carA carbamoyl phosphate synthase small subunit
NLDBIP_09850 NLDBIP_09850 93.9 Morganella morganii S4 carA carbamoyl phosphate synthase small subunit
LHKJJB_07905 LHKJJB_07905 93.9 Morganella morganii S3 carA carbamoyl phosphate synthase small subunit
HKOGLL_07455 HKOGLL_07455 93.9 Morganella morganii S5 carA carbamoyl phosphate synthase small subunit
PMI_RS00100 PMI_RS00100 80.2 Proteus mirabilis HI4320 carA glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit

Distribution of the homologs in the orthogroup group_1187

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1187

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A6F1 0.0 682 85 0 378 1 carA Carbamoyl phosphate synthase small chain Escherichia coli (strain K12)
P0A6F2 0.0 682 85 0 378 3 carA Carbamoyl phosphate synthase small chain Escherichia coli O157:H7
Q8FLB1 0.0 681 85 0 378 3 carA Carbamoyl phosphate synthase small chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P14845 0.0 673 84 0 379 3 carA Carbamoyl phosphate synthase small chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z9L8 0.0 672 84 0 378 3 carA Carbamoyl phosphate synthase small chain Salmonella typhi
Q7N8W2 0.0 654 81 1 384 3 carA Carbamoyl phosphate synthase small chain Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6D0C8 0.0 653 81 0 378 3 carA Carbamoyl phosphate synthase small chain Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q66ER8 0.0 646 82 0 378 3 carA Carbamoyl phosphate synthase small chain Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZIL5 0.0 646 82 0 378 3 carA Carbamoyl phosphate synthase small chain Yersinia pestis
Q9KPH8 0.0 638 79 0 378 3 carA Carbamoyl phosphate synthase small chain Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8DEM1 0.0 636 79 0 376 3 carA Carbamoyl phosphate synthase small chain Vibrio vulnificus (strain CMCP6)
Q7MNU1 0.0 636 79 0 376 3 carA Carbamoyl phosphate synthase small chain Vibrio vulnificus (strain YJ016)
Q87SF4 0.0 631 78 0 375 3 carA Carbamoyl phosphate synthase small chain Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6LUK6 0.0 620 77 0 375 3 carA Carbamoyl phosphate synthase small chain Photobacterium profundum (strain SS9)
Q8EHS6 0.0 597 74 0 379 3 carA Carbamoyl phosphate synthase small chain Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B8GNX4 0.0 557 71 3 375 3 carA Carbamoyl phosphate synthase small chain Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
C5BQ30 0.0 556 71 2 372 3 carA Carbamoyl phosphate synthase small chain Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q8RSS4 0.0 556 70 3 384 3 carA Carbamoyl phosphate synthase small chain Halomonas eurihalina
Q6F8M7 0.0 556 69 3 382 3 carA Carbamoyl phosphate synthase small chain Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P38098 0.0 555 70 0 378 3 carA Carbamoyl phosphate synthase small chain Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q87WP3 0.0 540 68 0 378 3 carA Carbamoyl phosphate synthase small chain Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88DU5 0.0 536 68 0 378 3 carA Carbamoyl phosphate synthase small chain Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P57245 0.0 531 65 0 370 3 carA Carbamoyl phosphate synthase small chain Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P38099 0.0 527 68 0 370 3 carA Carbamoyl phosphate synthase small chain Stutzerimonas stutzeri
Q9CKV3 0.0 514 65 2 377 3 carA Carbamoyl phosphate synthase small chain Pasteurella multocida (strain Pm70)
Q8K9Z6 0.0 513 63 0 374 3 carA Carbamoyl phosphate synthase small chain Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9JXX4 0.0 511 65 1 378 3 carA Carbamoyl phosphate synthase small chain Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JVZ6 0.0 511 64 1 378 3 carA Carbamoyl phosphate synthase small chain Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q50983 4.01e-178 503 63 1 379 3 carA Carbamoyl phosphate synthase small chain Neisseria gonorrhoeae
A4SXM1 4.83e-176 498 63 3 386 3 carA Carbamoyl phosphate synthase small chain Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q8XZ85 3.91e-175 495 64 3 379 3 carA Carbamoyl phosphate synthase small chain Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B1XUM3 1.79e-173 491 63 4 385 3 carA Carbamoyl phosphate synthase small chain Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q7VP66 3.98e-173 490 61 5 389 3 carA Carbamoyl phosphate synthase small chain Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P58895 1.23e-172 489 61 3 388 3 carA Carbamoyl phosphate synthase small chain Xanthomonas axonopodis pv. citri (strain 306)
P58896 4.03e-172 487 62 2 378 3 carA Carbamoyl phosphate synthase small chain Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q87EB9 3.82e-171 485 63 3 377 3 carA Carbamoyl phosphate synthase small chain Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PEC2 9.58e-171 484 62 3 377 3 carA Carbamoyl phosphate synthase small chain Xylella fastidiosa (strain 9a5c)
Q9JP87 1.07e-169 481 63 3 383 3 carA Carbamoyl phosphate synthase small chain Rubrivivax gelatinosus (strain NBRC 100245 / IL144)
P59576 1.42e-158 454 56 1 375 3 carA Carbamoyl phosphate synthase small chain Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A1UTE8 3.24e-134 392 53 6 383 3 carA Carbamoyl phosphate synthase small chain Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q3A450 6.71e-134 390 53 3 376 3 carA Carbamoyl phosphate synthase small chain Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q8D3H7 5.66e-131 383 49 2 379 3 carA Carbamoyl phosphate synthase small chain Wigglesworthia glossinidia brevipalpis
Q5LTN6 5.98e-131 383 52 6 378 3 carA Carbamoyl phosphate synthase small chain Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B4S5S1 7.64e-131 382 50 3 379 3 carA Carbamoyl phosphate synthase small chain Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A6WZJ5 6.93e-129 379 52 6 384 3 carA Carbamoyl phosphate synthase small chain Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q7UGJ6 2.1e-127 374 53 5 378 3 carA Carbamoyl phosphate synthase small chain Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
O50235 4.16e-127 373 51 4 376 3 carA Carbamoyl phosphate synthase small chain Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q6YV23 5.12e-127 375 49 4 380 2 CARA Carbamoyl phosphate synthase small chain, chloroplastic Oryza sativa subsp. japonica
Q6FZ66 3.46e-126 372 49 5 384 3 carA Carbamoyl phosphate synthase small chain Bartonella quintana (strain Toulouse)
Q89DR8 5.41e-126 371 50 4 382 3 carA Carbamoyl phosphate synthase small chain Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q92N95 1.43e-125 370 51 5 383 3 carA Carbamoyl phosphate synthase small chain Rhizobium meliloti (strain 1021)
Q8FZJ8 4.95e-125 369 51 5 385 3 carA Carbamoyl phosphate synthase small chain Brucella suis biovar 1 (strain 1330)
B0CHS0 4.95e-125 369 51 5 385 3 carA Carbamoyl phosphate synthase small chain Brucella suis (strain ATCC 23445 / NCTC 10510)
A9M6F1 4.95e-125 369 51 5 385 3 carA Carbamoyl phosphate synthase small chain Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q8KGA2 1.71e-124 366 50 3 377 3 carA Carbamoyl phosphate synthase small chain Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q31LB7 1.8e-124 367 51 4 377 3 carA Carbamoyl phosphate synthase small chain Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A5VRM1 2.08e-124 367 50 5 385 3 carA Carbamoyl phosphate synthase small chain Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YIB8 2.08e-124 367 50 5 385 3 carA Carbamoyl phosphate synthase small chain Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0REC2 2.08e-124 367 50 5 385 3 carA Carbamoyl phosphate synthase small chain Brucella melitensis biotype 2 (strain ATCC 23457)
Q57C28 2.08e-124 367 50 5 385 3 carA Carbamoyl phosphate synthase small chain Brucella abortus biovar 1 (strain 9-941)
Q2YM22 2.08e-124 367 50 5 385 3 carA Carbamoyl phosphate synthase small chain Brucella abortus (strain 2308)
B2S6U9 2.08e-124 367 50 5 385 3 carA Carbamoyl phosphate synthase small chain Brucella abortus (strain S19)
P74587 3.09e-124 366 50 5 379 3 carA Carbamoyl phosphate synthase small chain Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A9IWF8 5.02e-124 366 51 5 382 3 carA Carbamoyl phosphate synthase small chain Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q6G5M0 5.85e-124 366 49 5 384 3 carA Carbamoyl phosphate synthase small chain Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q98IA7 8.65e-124 365 51 5 384 3 carA Carbamoyl phosphate synthase small chain Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q5N0L0 3.37e-123 363 50 4 377 3 carA Carbamoyl phosphate synthase small chain Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q8DKU5 8.1e-123 362 51 5 383 3 carA Carbamoyl phosphate synthase small chain Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8UDF7 1.26e-122 362 49 5 384 3 carA Carbamoyl phosphate synthase small chain Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9A4J7 7.4e-122 360 49 6 384 3 carA Carbamoyl phosphate synthase small chain Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9LVW7 1.57e-120 358 47 4 379 1 CARA Carbamoyl phosphate synthase small chain, chloroplastic Arabidopsis thaliana
P51201 1.71e-119 354 48 7 382 3 carA Carbamoyl phosphate synthase small chain Porphyra purpurea
Q8YXQ7 1.13e-117 349 48 3 376 3 carA Carbamoyl phosphate synthase small chain Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
O66727 1.7e-117 348 47 3 373 3 carA Carbamoyl phosphate synthase small chain Aquifex aeolicus (strain VF5)
Q8F6R2 6.62e-114 339 47 4 374 3 carA Carbamoyl phosphate synthase small chain Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q7U7F9 3.01e-113 338 48 5 378 3 carA Carbamoyl phosphate synthase small chain Parasynechococcus marenigrum (strain WH8102)
Q04ZG6 3.04e-113 337 47 5 376 3 carA Carbamoyl phosphate synthase small chain Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04R57 3.04e-113 337 47 5 376 3 carA Carbamoyl phosphate synthase small chain Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q72PK5 3.14e-113 337 47 4 374 3 carA Carbamoyl phosphate synthase small chain Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q1XDT6 9.05e-112 334 46 7 381 3 carA Carbamoyl phosphate synthase small chain Neopyropia yezoensis
B2URJ0 1.97e-109 328 47 4 375 3 carA Carbamoyl phosphate synthase small chain Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
Q8CXH8 3.92e-107 322 46 6 382 3 carA Carbamoyl phosphate synthase small chain Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9RWI4 4.92e-107 322 46 6 383 3 carA Carbamoyl phosphate synthase small chain Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q1IWN0 5.08e-107 322 46 6 383 3 carA Carbamoyl phosphate synthase small chain Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q5SLL3 1.3e-106 321 45 6 380 3 carA Carbamoyl phosphate synthase small chain Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72GZ0 1.3e-106 321 45 6 380 3 carA Carbamoyl phosphate synthase small chain Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q9K9V8 1.6e-106 320 46 6 378 3 pyrAA Carbamoyl phosphate synthase pyrimidine-specific small chain Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q827Q8 1.21e-105 318 46 5 381 3 carA Carbamoyl phosphate synthase small chain Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q5HPY9 1.67e-105 318 44 6 381 3 carA Carbamoyl phosphate synthase small chain Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
C6C0A9 2.65e-105 317 45 6 378 3 carA Carbamoyl phosphate synthase small chain Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q4L5Q4 4.06e-105 317 45 6 381 3 carA Carbamoyl phosphate synthase small chain Staphylococcus haemolyticus (strain JCSC1435)
C4XRH8 5.85e-105 317 44 5 382 3 carA Carbamoyl phosphate synthase small chain Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q9KXR5 9.72e-105 316 45 5 381 3 carA Carbamoyl phosphate synthase small chain Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P52557 1.53e-104 315 47 6 370 3 carA Carbamoyl phosphate synthase small chain Bacillus caldolyticus
Q8Y664 2.1e-104 315 47 6 370 3 carA Carbamoyl phosphate synthase small chain Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q0BY73 2.41e-104 315 47 6 381 3 carA Carbamoyl phosphate synthase small chain Hyphomonas neptunium (strain ATCC 15444)
Q8CPJ5 2.41e-104 315 44 5 379 3 carA Carbamoyl phosphate synthase small chain Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q6B940 1.94e-103 313 43 7 379 3 carA Carbamoyl phosphate synthase small chain Gracilaria tenuistipitata var. liui
Q71YI0 3.17e-103 311 47 6 370 3 carA Carbamoyl phosphate synthase small chain Listeria monocytogenes serotype 4b (strain F2365)
P63730 3.85e-103 311 45 6 384 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain MW2)
Q6GA11 3.85e-103 311 45 6 384 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain MSSA476)
P99147 3.85e-103 311 45 6 384 1 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain N315)
P63729 3.85e-103 311 45 6 384 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGN0 3.85e-103 311 45 6 384 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain COL)
Q7VHS5 5.71e-103 311 43 5 378 3 carA Carbamoyl phosphate synthase small chain Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q6GHN3 5.81e-103 311 45 6 378 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain MRSA252)
Q8RG87 1.39e-102 310 46 6 372 3 carA Carbamoyl phosphate synthase small chain Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q49WY3 2.9e-102 309 42 7 386 3 carA Carbamoyl phosphate synthase small chain Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9WZ28 3.23e-102 310 43 6 413 3 carA Carbamoyl phosphate synthase small chain Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q6NH15 3.81e-102 310 44 6 383 3 carA Carbamoyl phosphate synthase small chain Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q819S2 3.85e-102 309 46 6 373 3 carA Carbamoyl phosphate synthase small chain Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q732I2 4.11e-102 309 46 6 373 3 carA Carbamoyl phosphate synthase small chain Bacillus cereus (strain ATCC 10987 / NRS 248)
P63734 5.96e-102 308 44 4 370 3 carA Carbamoyl phosphate synthase small chain Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P63733 5.96e-102 308 44 4 370 3 carA Carbamoyl phosphate synthase small chain Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
O28995 6.43e-102 308 45 4 376 3 carA Carbamoyl phosphate synthase small chain Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q6HES7 7.46e-102 308 46 6 373 3 carA Carbamoyl phosphate synthase small chain Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81WF1 7.46e-102 308 46 6 373 3 carA Carbamoyl phosphate synthase small chain Bacillus anthracis
A5GTM5 8.3e-102 309 44 5 376 3 carA Carbamoyl phosphate synthase small chain Synechococcus sp. (strain RCC307)
Q0AMR3 1e-101 309 44 6 377 3 carA Carbamoyl phosphate synthase small chain Maricaulis maris (strain MCS10)
Q92AH2 1.56e-101 307 46 6 370 3 carA Carbamoyl phosphate synthase small chain Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P25993 3.03e-101 306 46 6 373 1 pyrAA Carbamoyl phosphate synthase pyrimidine-specific small chain Bacillus subtilis (strain 168)
A1VA26 4.64e-101 306 44 5 376 3 carA Carbamoyl phosphate synthase small chain Nitratidesulfovibrio vulgaris (strain DP4)
Q726J4 4.64e-101 306 44 5 376 1 carA Carbamoyl phosphate synthase small chain Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q636D9 5.62e-101 306 46 6 373 3 carA Carbamoyl phosphate synthase small chain Bacillus cereus (strain ZK / E33L)
P0DA13 1.39e-100 305 43 5 373 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M3 (strain SSI-1)
Q5XCR8 1.39e-100 305 43 5 373 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DA12 1.39e-100 305 43 5 373 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P63735 1.39e-100 305 43 5 373 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M1
Q8XHB2 2.04e-100 304 44 6 369 3 carA Carbamoyl phosphate synthase small chain Clostridium perfringens (strain 13 / Type A)
Q67Q55 2.83e-100 304 45 4 373 3 carA Carbamoyl phosphate synthase small chain Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P58894 4.29e-100 303 43 5 373 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q8G816 5.34e-100 305 44 5 392 3 carA Carbamoyl phosphate synthase small chain Bifidobacterium longum (strain NCC 2705)
Q58425 5.96e-100 303 43 6 373 3 carA Carbamoyl phosphate synthase small chain Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
B7GPW1 1.13e-99 304 44 5 392 3 carA Carbamoyl phosphate synthase small chain Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
B3DQ31 1.74e-99 304 44 6 393 3 carA Carbamoyl phosphate synthase small chain Bifidobacterium longum (strain DJO10A)
P77885 1.96e-99 302 44 4 369 3 pyrAA Carbamoyl phosphate synthase pyrimidine-specific small chain Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q97FT2 2.08e-99 301 41 7 372 3 carA Carbamoyl phosphate synthase small chain Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8FT41 2.21e-99 303 45 8 382 3 carA Carbamoyl phosphate synthase small chain Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q9CF80 4.52e-98 298 42 6 373 3 carA Carbamoyl phosphate synthase small chain Lactococcus lactis subsp. lactis (strain IL1403)
Q9L4N5 9.88e-98 297 43 6 374 3 carA Carbamoyl phosphate synthase small chain Lactococcus lactis subsp. cremoris (strain MG1363)
P63732 2.04e-97 296 43 5 371 3 carA Carbamoyl phosphate synthase small chain Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P63731 2.04e-97 296 43 5 371 3 carA Carbamoyl phosphate synthase small chain Streptococcus agalactiae serotype III (strain NEM316)
Q8KZA0 2.3e-96 295 42 5 384 3 carA Carbamoyl phosphate synthase small chain Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q8DUP4 4.29e-96 293 42 5 369 3 carA Carbamoyl phosphate synthase small chain Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
O19886 5.58e-96 295 41 8 393 3 carA Carbamoyl phosphate synthase small chain Cyanidium caldarium
Q9PMG8 1.56e-95 292 39 5 376 3 carA Carbamoyl phosphate synthase small chain Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P9WPK5 3.2e-95 291 44 5 386 1 carA Carbamoyl phosphate synthase small chain Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPK4 3.2e-95 291 44 5 386 3 carA Carbamoyl phosphate synthase small chain Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7U055 4.24e-95 291 44 5 386 3 carA Carbamoyl phosphate synthase small chain Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8TY15 1.54e-94 290 42 4 376 3 carA Carbamoyl phosphate synthase small chain Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
A9A972 5.14e-94 288 40 5 378 3 carA Carbamoyl phosphate synthase small chain Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
A6VHH7 6.46e-94 288 40 5 378 3 carA Carbamoyl phosphate synthase small chain Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
P58893 7.37e-94 289 45 7 381 3 carA Carbamoyl phosphate synthase small chain Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4G0Y3 3.39e-93 286 40 6 378 3 carA Carbamoyl phosphate synthase small chain Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Q8RBK1 6.5e-93 285 43 6 369 3 carA Carbamoyl phosphate synthase small chain Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q6LWW5 1.9e-92 284 39 5 378 3 carA Carbamoyl phosphate synthase small chain Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q741H2 1.69e-91 282 44 6 387 3 carA Carbamoyl phosphate synthase small chain Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
O27079 7.51e-90 277 41 4 371 3 carA Carbamoyl phosphate synthase small chain Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
B8IZS6 1.68e-88 275 43 8 376 3 carA Carbamoyl phosphate synthase small chain Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q17VI1 3.29e-88 274 41 7 379 3 carA Carbamoyl phosphate synthase small chain Helicobacter acinonychis (strain Sheeba)
A6UQN4 1.74e-87 271 41 9 379 3 carA Carbamoyl phosphate synthase small chain Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q8Q0U4 5.42e-87 270 41 5 367 3 carA Carbamoyl phosphate synthase small chain Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8TNY3 5.91e-87 270 41 5 367 3 carA Carbamoyl phosphate synthase small chain Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q1MPN3 3.65e-86 268 40 7 380 3 carA Carbamoyl phosphate synthase small chain Lawsonia intracellularis (strain PHE/MN1-00)
Q9CCR3 5.58e-86 268 42 7 389 3 carA Carbamoyl phosphate synthase small chain Mycobacterium leprae (strain TN)
Q9ZJY9 1.04e-85 267 41 8 377 3 carA Carbamoyl phosphate synthase small chain Helicobacter pylori (strain J99 / ATCC 700824)
O25835 4.84e-85 266 41 7 378 3 carA Carbamoyl phosphate synthase small chain Helicobacter pylori (strain ATCC 700392 / 26695)
Q6C9Y4 4.09e-84 266 40 6 389 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Yarrowia lipolytica (strain CLIB 122 / E 150)
Q6BJG4 7.98e-84 264 40 6 386 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q2H132 1.01e-83 265 40 6 378 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
Q5AML6 2.05e-82 261 41 5 380 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Candida albicans (strain SC5314 / ATCC MYA-2876)
P22572 1.99e-80 256 40 7 374 1 arg-2 Carbamoyl phosphate synthase arginine-specific small chain Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P54324 2.83e-80 253 38 6 373 1 carA Carbamoyl phosphate synthase arginine-specific small chain Geobacillus stearothermophilus
P87183 2.46e-79 253 39 6 384 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Hypocrea virens
O60060 3.5e-79 252 39 6 379 3 arg5 Carbamoyl phosphate synthase arginine-specific small chain Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A1CZ92 6.05e-79 252 38 7 386 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Q4WU09 1.01e-78 252 38 7 386 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q1DUF5 4.72e-78 251 37 7 385 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Coccidioides immitis (strain RS)
Q0U5H7 5.59e-78 251 37 6 387 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
Q5BB37 7.57e-78 249 37 7 387 2 cpa-1 Carbamoyl phosphate synthase arginine-specific small chain Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A1CA18 4.47e-77 248 38 7 386 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
Q6CIQ1 6.13e-77 246 39 9 381 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q2U913 7.93e-77 247 37 7 386 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Aspergillus oryzae (strain ATCC 42149 / RIB 40)
A2R9B9 1.29e-76 246 38 8 388 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
P36838 3.31e-76 242 37 8 375 3 carA Carbamoyl phosphate synthase arginine-specific small chain Bacillus subtilis (strain 168)
Q9K8V6 3.4e-76 242 38 5 369 3 carA Carbamoyl phosphate synthase arginine-specific small chain Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P07258 2.41e-74 239 38 7 383 1 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O08317 2.48e-74 238 38 6 367 2 carA Carbamoyl phosphate synthase arginine-specific small chain Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8U086 4.49e-74 237 37 8 386 3 carA Carbamoyl phosphate synthase small chain Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q8ZY49 1.79e-73 235 37 9 373 3 carA Carbamoyl phosphate synthase small chain Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
O93937 1.34e-71 246 39 8 394 3 pyrABCN Multifunctional protein pyrABCN Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q91437 2.15e-71 246 39 6 385 2 CAD Multifunctional protein CAD Squalus acanthias
Q6FQ30 2.6e-71 231 37 9 383 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q752N9 9.97e-70 227 37 10 394 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q18990 3.11e-69 239 37 9 393 1 pyr-1 Multifunctional protein pyr-1 Caenorhabditis elegans
P20054 4.12e-69 239 37 8 387 1 pyr1-3 Multifunctional protein pyr1-3 Dictyostelium discoideum
P27708 1.84e-68 237 38 7 384 1 CAD Multifunctional protein CAD Homo sapiens
Q09794 5.88e-68 236 35 8 400 1 ura1 Multifunctional protein ura1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B2RQC6 1.08e-67 235 38 7 385 1 Cad Multifunctional protein CAD Mus musculus
P08955 2.25e-67 234 38 7 385 1 CAD Multifunctional protein CAD Mesocricetus auratus
P05990 2.43e-67 234 38 7 389 1 r Multifunctional protein r Drosophila melanogaster
P31327 1.02e-66 232 37 8 389 1 CPS1 Carbamoyl-phosphate synthase [ammonia], mitochondrial Homo sapiens
Q7S8A6 3.25e-66 231 36 9 397 1 pyr-3 Multifunctional protein pyr-3 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q8C196 7.69e-65 227 36 8 389 1 Cps1 Carbamoyl-phosphate synthase [ammonia], mitochondrial Mus musculus
P07259 8.73e-65 227 36 10 406 1 URA2 Multifunctional protein URA2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P07756 1.79e-64 226 36 8 389 1 Cps1 Carbamoyl-phosphate synthase [ammonia], mitochondrial Rattus norvegicus
Q91293 4.74e-61 216 35 7 389 2 None Carbamoyl-phosphate synthase [ammonia], mitochondrial Aquarana catesbeiana
Q970U8 1.58e-60 202 33 9 386 3 carA Carbamoyl phosphate synthase small chain Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q59968 2.54e-60 202 33 8 379 3 carA Carbamoyl phosphate synthase small chain Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
A4YI77 4.94e-60 201 30 4 378 3 carA Carbamoyl phosphate synthase small chain Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
Q9HP42 2.44e-59 199 35 8 376 3 carA Carbamoyl phosphate synthase small chain Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R6F1 2.44e-59 199 35 8 376 3 carA Carbamoyl phosphate synthase small chain Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q97AJ4 1.91e-56 191 37 12 364 3 carA Carbamoyl phosphate synthase small chain Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q4J8E9 5.07e-56 191 32 7 382 3 carA Carbamoyl phosphate synthase small chain Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q9HK16 6.88e-48 169 33 14 378 3 carA Carbamoyl phosphate synthase small chain Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q08654 7.32e-17 85 30 5 177 3 trpGD Bifunctional protein TrpGD Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9YGB2 1.03e-15 78 30 4 172 3 trpG Anthranilate synthase component 2 Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q57690 6.82e-13 70 28 4 179 3 trpG Anthranilate synthase component 2 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P28819 9.97e-13 69 26 6 179 2 pabA Aminodeoxychorismate/anthranilate synthase component 2 Bacillus subtilis (strain 168)
P15395 1.61e-12 72 32 5 149 4 trpE(G) Anthranilate synthase Rhizobium meliloti (strain 1021)
P26922 2.28e-12 68 29 6 186 1 trpG Anthranilate synthase component 2 Azospirillum brasilense
P06194 3.88e-12 67 29 6 179 3 pabA Aminodeoxychorismate synthase component 2 Klebsiella aerogenes
Q5V632 4.39e-12 67 34 3 138 3 trpG2 Anthranilate synthase component II Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q1XDC5 2e-11 65 28 3 135 4 trpG Anthranilate synthase component 2 Neopyropia yezoensis
P06195 1.69e-10 63 29 4 154 3 pabA Aminodeoxychorismate synthase component 2 Serratia marcescens
Q0W700 1.78e-10 63 29 9 188 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
Q8PXF0 2.57e-10 62 32 6 159 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P51362 3.42e-10 62 29 3 136 4 trpG Anthranilate synthase component 2 Porphyra purpurea
Q06129 8.04e-10 61 30 4 139 1 trpG Anthranilate synthase component 2 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P00901 1.43e-09 60 28 8 183 1 trpG Anthranilate synthase component 2 Pseudomonas putida
Q47LQ0 1.51e-09 63 29 8 190 3 guaA GMP synthase [glutamine-hydrolyzing] Thermobifida fusca (strain YX)
P20576 2.59e-09 60 27 7 181 1 trpG Anthranilate synthase component 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P00902 2.61e-09 59 24 7 198 3 trpG Anthranilate synthase component 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P9WN35 3.43e-09 60 28 2 129 1 trpG Anthranilate synthase component 2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN34 3.43e-09 60 28 2 129 3 trpG Anthranilate synthase component 2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8RDR4 4.75e-09 61 29 11 184 3 guaA GMP synthase [glutamine-hydrolyzing] Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q42565 6.17e-09 60 29 5 165 1 ASB1 Anthranilate synthase beta subunit 1, chloroplastic Arabidopsis thaliana
P06193 1.08e-08 57 29 3 132 3 pabA Aminodeoxychorismate synthase component 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P48261 1.4e-08 57 27 9 180 3 trpG Anthranilate synthase component 2 Cyanophora paradoxa
Q7XUS2 1.9e-08 58 27 6 166 1 ASB1 Anthranilate synthase beta subunit 1, chloroplastic Oryza sativa subsp. japonica
Q8G5P4 3.33e-08 58 27 6 176 3 guaA GMP synthase [glutamine-hydrolyzing] Bifidobacterium longum (strain NCC 2705)
O59071 3.66e-08 56 35 3 94 1 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q46E00 3.69e-08 56 28 6 177 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanosarcina barkeri (strain Fusaro / DSM 804)
Q8THC7 4.02e-08 56 29 6 162 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
P32483 4.12e-08 58 33 6 150 3 pabAB Aminodeoxychorismate synthase Streptomyces griseus
B9MS76 4.62e-08 58 31 3 110 3 guaA GMP synthase [glutamine-hydrolyzing] Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q9FJM5 4.92e-08 57 26 6 185 2 ASB2 Anthranilate synthase beta subunit 2, chloroplastic Arabidopsis thaliana
O28949 5.41e-08 55 27 9 196 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q12UJ5 6.05e-08 55 29 8 161 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q5JFM4 7.55e-08 55 27 7 198 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q2NER5 9.47e-08 55 25 7 193 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q04CA4 1.01e-07 57 33 2 104 3 guaA GMP synthase [glutamine-hydrolyzing] Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBU7 1.01e-07 57 33 2 104 3 guaA GMP synthase [glutamine-hydrolyzing] Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q764B9 1.02e-07 56 27 5 143 1 ASB2 Anthranilate synthase beta subunit 2, chloroplastic Oryza sativa subsp. japonica
P72539 1.02e-07 57 28 4 167 3 papA Aminodeoxychorismate synthase Streptomyces pristinaespiralis
A4XKX8 1.14e-07 57 26 7 175 3 guaA GMP synthase [glutamine-hydrolyzing] Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
P20441 1.58e-07 54 28 5 161 3 trpG Anthranilate synthase component 2 Leptospira biflexa
A8ETA7 1.63e-07 56 27 8 177 3 guaA GMP synthase [glutamine-hydrolyzing] Aliarcobacter butzleri (strain RM4018)
Q9V0I6 1.97e-07 54 34 3 94 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Pyrococcus abyssi (strain GE5 / Orsay)
Q8U0R9 2.57e-07 53 25 7 183 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
C0R5H8 2.7e-07 55 25 8 202 3 guaA GMP synthase [glutamine-hydrolyzing] Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q73IH1 2.7e-07 55 25 8 202 3 guaA GMP synthase [glutamine-hydrolyzing] Wolbachia pipientis wMel
B2G994 3.02e-07 55 27 7 174 3 guaA GMP synthase [glutamine-hydrolyzing] Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLY3 3.02e-07 55 27 7 174 3 guaA GMP synthase [glutamine-hydrolyzing] Limosilactobacillus reuteri (strain DSM 20016)
B2UZ05 3.17e-07 55 27 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain Alaska E43 / Type E3)
Q02003 3.85e-07 53 28 7 149 3 trpG Anthranilate synthase component 2 Lactococcus lactis subsp. lactis (strain IL1403)
A6TLR3 5.27e-07 55 26 6 175 3 guaA GMP synthase [glutamine-hydrolyzing] Alkaliphilus metalliredigens (strain QYMF)
P00937 5.38e-07 55 27 7 164 1 TRP3 Multifunctional tryptophan biosynthesis protein Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
C5CBZ4 6.05e-07 55 28 8 183 3 guaA GMP synthase [glutamine-hydrolyzing] Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
P05379 6.36e-07 53 28 8 181 3 trpG Anthranilate synthase component 2 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P00903 6.71e-07 52 28 3 132 1 pabA Aminodeoxychorismate synthase component 2 Escherichia coli (strain K12)
Q046I2 7.17e-07 54 28 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
B7IUT1 9.63e-07 54 25 7 186 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain G9842)
B2TIX3 1.1e-06 53 26 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain Eklund 17B / Type B)
A0B5J1 1.15e-06 52 25 8 177 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
Q8DU81 1.31e-06 53 29 8 178 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q6ASN4 1.37e-06 53 26 6 176 3 guaA GMP synthase [glutamine-hydrolyzing] Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
A6Q4N8 1.43e-06 53 28 9 183 3 guaA GMP synthase [glutamine-hydrolyzing] Nitratiruptor sp. (strain SB155-2)
A6QBI5 1.47e-06 53 29 9 178 3 guaA GMP synthase [glutamine-hydrolyzing] Sulfurovum sp. (strain NBC37-1)
O28670 1.67e-06 51 29 8 151 3 trpG Anthranilate synthase component 2 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
B3CPU7 1.68e-06 53 23 7 202 3 guaA GMP synthase [glutamine-hydrolyzing] Wolbachia pipientis subsp. Culex pipiens (strain wPip)
Q9L0H2 1.71e-06 53 28 8 191 3 guaA GMP synthase [glutamine-hydrolyzing] Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q0IE37 1.71e-06 53 28 8 178 3 guaA GMP synthase [glutamine-hydrolyzing] Synechococcus sp. (strain CC9311)
P71381 1.91e-06 51 31 6 133 3 trpG Anthranilate synthase component 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q81IS3 1.92e-06 53 25 7 186 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P24773 2.17e-06 53 25 5 182 3 trpC Multifunctional tryptophan biosynthesis protein Penicillium chrysogenum
Q65MU0 2.66e-06 52 29 8 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
O26805 2.76e-06 50 24 6 166 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q3AD70 2.82e-06 52 25 8 193 3 guaA GMP synthase [glutamine-hydrolyzing] Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q979P8 2.95e-06 51 25 6 180 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
A7GKG1 3.09e-06 52 24 7 186 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q72IE5 3.2e-06 52 27 7 194 3 guaA GMP synthase [glutamine-hydrolyzing] Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
B7H4Q8 3.37e-06 52 25 7 186 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain B4264)
Q5GSJ3 3.56e-06 52 23 6 196 3 guaA GMP synthase [glutamine-hydrolyzing] Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q5SI28 3.95e-06 52 28 7 189 1 guaA GMP synthase [glutamine-hydrolyzing] Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P00908 4.17e-06 52 28 6 166 3 trp-1 Multifunctional tryptophan biosynthesis protein Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P29727 4.44e-06 52 35 3 97 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus subtilis (strain 168)
Q5X4I9 4.83e-06 52 25 7 180 3 guaA GMP synthase [glutamine-hydrolyzing] Legionella pneumophila (strain Paris)
Q5WVX4 5.04e-06 52 25 7 180 3 guaA GMP synthase [glutamine-hydrolyzing] Legionella pneumophila (strain Lens)
A5ICM2 5.65e-06 52 26 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Legionella pneumophila (strain Corby)
Q2RGP2 6.07e-06 51 33 3 95 3 guaA GMP synthase [glutamine-hydrolyzing] Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q74LF7 6.07e-06 51 25 6 173 3 guaA GMP synthase [glutamine-hydrolyzing] Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A7Z235 6.1e-06 51 29 8 179 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A5N5D9 6.76e-06 51 23 4 173 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYY7 6.76e-06 51 23 4 173 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium kluyveri (strain NBRC 12016)
B0U3R8 6.84e-06 51 27 9 193 3 guaA GMP synthase [glutamine-hydrolyzing] Xylella fastidiosa (strain M12)
Q87BK6 7.15e-06 51 28 10 189 3 guaA GMP synthase [glutamine-hydrolyzing] Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6W2 7.15e-06 51 28 10 189 3 guaA GMP synthase [glutamine-hydrolyzing] Xylella fastidiosa (strain M23)
A9VQG9 8.44e-06 51 24 7 186 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus mycoides (strain KBAB4)
Q1QKC3 8.99e-06 51 26 9 199 3 guaA GMP synthase [glutamine-hydrolyzing] Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q4JTG0 9.55e-06 51 28 7 194 3 guaA GMP synthase [glutamine-hydrolyzing] Corynebacterium jeikeium (strain K411)
Q839J8 9.72e-06 51 34 3 93 3 guaA GMP synthase [glutamine-hydrolyzing] Enterococcus faecalis (strain ATCC 700802 / V583)
B2KCS8 1.07e-05 50 32 4 108 3 guaA GMP synthase [glutamine-hydrolyzing] Elusimicrobium minutum (strain Pei191)
C1CLE8 1.12e-05 50 29 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain P1031)
Q73ER7 1.15e-05 50 24 7 186 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain ATCC 10987 / NRS 248)
O27693 1.24e-05 49 27 6 140 3 trpG Anthranilate synthase component 2 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q9HSH4 1.25e-05 48 26 7 152 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q58970 1.39e-05 48 28 7 171 1 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
B7K8T7 1.49e-05 50 27 8 173 3 guaA GMP synthase [glutamine-hydrolyzing] Gloeothece citriformis (strain PCC 7424)
A8FAH5 1.58e-05 50 34 3 97 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus pumilus (strain SAFR-032)
Q1J0T4 1.62e-05 50 28 8 197 3 guaA GMP synthase [glutamine-hydrolyzing] Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q8LPN3 1.68e-05 50 30 5 118 1 ADCS Aminodeoxychorismate synthase, chloroplastic Arabidopsis thaliana
P06531 1.77e-05 50 25 6 184 2 trpC Multifunctional tryptophan biosynthesis protein Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q8DGA5 2.06e-05 50 27 10 179 3 guaA GMP synthase [glutamine-hydrolyzing] Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P20409 2.09e-05 50 25 3 160 3 trp1 Multifunctional tryptophan biosynthesis protein Phycomyces blakesleeanus
P05328 2.43e-05 50 26 4 165 3 trpC Multifunctional tryptophan biosynthesis protein Aspergillus niger
Q8RC63 2.45e-05 49 24 5 179 3 guaA GMP synthase [glutamine-hydrolyzing] Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P26923 2.86e-05 48 25 6 166 3 trpG Anthranilate synthase component 2 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
C1CF29 3.02e-05 49 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain JJA)
B8ZKZ5 3.02e-05 49 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
O25165 3.18e-05 49 34 3 88 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter pylori (strain ATCC 700392 / 26695)
P09575 3.45e-05 48 25 3 160 4 None Multifunctional tryptophan biosynthesis protein (Fragment) Pichia angusta
C1CQS0 3.57e-05 49 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain Taiwan19F-14)
P64298 3.57e-05 49 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P64297 3.57e-05 49 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B1ICM9 3.57e-05 49 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain Hungary19A-6)
C1C842 3.57e-05 49 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain 70585)
B5E5U0 3.57e-05 49 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae serotype 19F (strain G54)
Q04JQ8 3.57e-05 49 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B2IQR1 3.73e-05 49 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain CGSP14)
A6SZM5 4e-05 49 26 6 180 3 guaA GMP synthase [glutamine-hydrolyzing] Janthinobacterium sp. (strain Marseille)
Q18KM8 4.18e-05 47 27 7 159 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
B3ELI1 4.35e-05 48 29 8 181 3 guaA GMP synthase [glutamine-hydrolyzing] Chlorobium phaeobacteroides (strain BS1)
Q38ZE1 4.56e-05 48 30 3 92 3 guaA GMP synthase [glutamine-hydrolyzing] Latilactobacillus sakei subsp. sakei (strain 23K)
Q9KF78 4.58e-05 48 35 4 97 3 guaA Putative GMP synthase [glutamine-hydrolyzing] Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B7IHI2 5.66e-05 48 33 4 104 3 guaA GMP synthase [glutamine-hydrolyzing] Thermosipho africanus (strain TCF52B)
Q8Y822 5.94e-05 48 26 5 173 3 guaA GMP synthase [glutamine-hydrolyzing] Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q7NHC2 5.95e-05 48 29 2 101 3 guaA GMP synthase [glutamine-hydrolyzing] Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q891G7 6.1e-05 48 25 7 180 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium tetani (strain Massachusetts / E88)
Q3ITY2 6.14e-05 47 27 7 161 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q82HM9 6.19e-05 48 25 7 191 3 guaA GMP synthase [glutamine-hydrolyzing] Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q756B7 6.36e-05 48 27 9 199 3 GUA1 GMP synthase [glutamine-hydrolyzing] Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q83GZ6 6.56e-05 48 33 2 101 3 guaA GMP synthase [glutamine-hydrolyzing] Tropheryma whipplei (strain Twist)
P14952 6.69e-05 44 41 1 53 3 trpG Anthranilate synthase component 2 (Fragment) Acetivibrio thermocellus
O52831 6.69e-05 48 29 8 194 3 guaA GMP synthase [glutamine-hydrolyzing] Corynebacterium ammoniagenes
Q8YT80 7.22e-05 48 31 4 106 3 guaA GMP synthase [glutamine-hydrolyzing] Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P0CL64 8.02e-05 48 23 5 173 3 guaA GMP synthase [glutamine-hydrolyzing] Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
A7I131 9e-05 48 26 10 189 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q720X7 9.02e-05 48 26 5 173 3 guaA GMP synthase [glutamine-hydrolyzing] Listeria monocytogenes serotype 4b (strain F2365)
Q92CU0 9.21e-05 48 26 5 171 3 guaA GMP synthase [glutamine-hydrolyzing] Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9HJM3 9.8e-05 46 26 6 184 1 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
B2UUF1 0.000101 47 34 3 88 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter pylori (strain Shi470)
B5ZYE9 0.000107 47 25 8 195 3 guaA GMP synthase [glutamine-hydrolyzing] Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q8DZX7 0.000108 47 25 7 174 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E5M8 0.000108 47 25 7 174 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus agalactiae serotype III (strain NEM316)
Q3K1C0 0.000108 47 25 7 174 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
A6LKY1 0.000117 47 32 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
A3PA84 0.000122 47 25 9 181 3 guaA GMP synthase [glutamine-hydrolyzing] Prochlorococcus marinus (strain MIT 9301)
A0Q2S8 0.000127 47 30 3 96 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium novyi (strain NT)
O25868 0.000131 46 29 5 128 3 trpG Anthranilate synthase component 2 Helicobacter pylori (strain ATCC 700392 / 26695)
Q83ID3 0.000133 47 32 2 101 3 guaA GMP synthase [glutamine-hydrolyzing] Tropheryma whipplei (strain TW08/27)
F2RB79 0.000141 47 30 5 130 1 cmlB Aminodeoxychorismate synthase Streptomyces venezuelae (strain ATCC 10712 / CBS 650.69 / DSM 40230 / JCM 4526 / NBRC 13096 / PD 04745)
A4G4U7 0.000146 47 25 7 181 3 guaA GMP synthase [glutamine-hydrolyzing] Herminiimonas arsenicoxydans
C4ZCQ4 0.000156 47 26 6 173 3 guaA GMP synthase [glutamine-hydrolyzing] Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q6MLD2 0.000158 47 27 10 195 3 guaA GMP synthase [glutamine-hydrolyzing] Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q5Z856 0.000159 47 44 3 63 2 ADCS Probable aminodeoxychorismate synthase, chloroplastic Oryza sativa subsp. japonica
Q5M4P4 0.000162 47 26 8 181 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M029 0.000166 47 26 8 181 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus thermophilus (strain CNRZ 1066)
B9KFL4 0.000169 47 32 3 93 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
E4QHI6 0.000169 47 23 5 173 3 guaA GMP synthase [glutamine-hydrolyzing] Borreliella burgdorferi (strain N40)
O94277 0.000172 47 29 8 155 3 SPBP8B7.29 Putative aminodeoxychorismate synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
C1D0M2 0.000172 47 32 3 97 3 guaA GMP synthase [glutamine-hydrolyzing] Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
Q9ZJU6 0.000215 45 28 5 128 3 trpG Anthranilate synthase component 2 Helicobacter pylori (strain J99 / ATCC 700824)
B5Z842 0.000218 47 32 3 88 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter pylori (strain G27)
Q5ZUS0 0.000219 47 23 7 180 3 guaA GMP synthase [glutamine-hydrolyzing] Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
O19914 0.000225 45 27 5 135 4 trpG Anthranilate synthase component 2 Cyanidium caldarium
B1YIZ1 0.000237 46 29 6 147 3 guaA GMP synthase [glutamine-hydrolyzing] Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
O66601 0.00024 46 25 7 179 3 guaA GMP synthase [glutamine-hydrolyzing] Aquifex aeolicus (strain VF5)
A4FW79 0.00024 45 27 6 145 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Q6TAS3 0.000245 47 25 7 179 1 ADCS Aminodeoxychorismate synthase, chloroplastic Solanum lycopersicum
B6JMN5 0.000248 46 32 3 88 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter pylori (strain P12)
Q17YH9 0.000253 46 34 3 88 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter acinonychis (strain Sheeba)
A0RQD7 0.000253 46 29 10 185 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter fetus subsp. fetus (strain 82-40)
Q9ZKG4 0.000255 46 32 3 88 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter pylori (strain J99 / ATCC 700824)
Q1CSM2 0.000255 46 32 3 88 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter pylori (strain HPAG1)
Q6G197 0.000262 46 26 8 197 3 guaA GMP synthase [glutamine-hydrolyzing] Bartonella quintana (strain Toulouse)
B2J9G3 0.000264 46 30 4 106 3 guaA GMP synthase [glutamine-hydrolyzing] Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
P50872 0.000267 46 29 3 130 4 trpE(G) Anthranilate synthase Azospirillum brasilense
Q5HTL3 0.000267 46 26 8 184 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter jejuni (strain RM1221)
Q7NSG1 0.000275 46 31 4 105 3 guaA GMP synthase [glutamine-hydrolyzing] Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B9DUB2 0.000279 46 25 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q03H14 0.000286 46 30 3 95 3 guaA GMP synthase [glutamine-hydrolyzing] Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B6IZE2 0.00029 46 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Coxiella burnetii (strain CbuG_Q212)
Q83BZ6 0.000295 46 30 3 102 1 guaA GMP synthase [glutamine-hydrolyzing] Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q5NN19 0.000298 46 30 3 103 3 guaA GMP synthase [glutamine-hydrolyzing] Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q5L3E1 0.000302 46 32 7 152 3 guaA GMP synthase [glutamine-hydrolyzing] Geobacillus kaustophilus (strain HTA426)
B6J7Z4 0.000308 46 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Coxiella burnetii (strain CbuK_Q154)
C3MCS5 0.00031 46 25 8 195 3 guaA GMP synthase [glutamine-hydrolyzing] Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A2BNG3 0.000318 46 27 10 181 3 guaA GMP synthase [glutamine-hydrolyzing] Prochlorococcus marinus (strain AS9601)
Q9PN49 0.000327 46 26 8 184 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A9N8L6 0.000343 46 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Coxiella burnetii (strain RSA 331 / Henzerling II)
Q311X7 0.000343 46 34 4 89 3 guaA GMP synthase [glutamine-hydrolyzing] Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q7V3N7 0.000344 46 27 10 179 3 guaA GMP synthase [glutamine-hydrolyzing] Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
P46810 0.000356 46 29 8 189 3 guaA GMP synthase [glutamine-hydrolyzing] Mycobacterium leprae (strain TN)
B8ZUE2 0.000356 46 29 8 189 3 guaA GMP synthase [glutamine-hydrolyzing] Mycobacterium leprae (strain Br4923)
Q9RT91 0.000371 46 23 8 200 3 guaA GMP synthase [glutamine-hydrolyzing] Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q1MMJ7 0.000383 46 25 9 201 3 guaA GMP synthase [glutamine-hydrolyzing] Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B9J7L1 0.000414 45 25 8 195 3 guaA GMP synthase [glutamine-hydrolyzing] Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A2BTY4 0.000424 45 26 10 179 3 guaA GMP synthase [glutamine-hydrolyzing] Prochlorococcus marinus (strain MIT 9515)
Q0VNF0 0.000441 45 31 3 103 3 guaA GMP synthase [glutamine-hydrolyzing] Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A2RED2 0.000468 45 24 6 174 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M5 (strain Manfredo)
P18483 0.00049 45 23 6 201 3 trpC Multifunctional tryptophan biosynthesis protein Aspergillus awamori
P60501 0.000497 45 32 3 100 3 guaA GMP synthase [glutamine-hydrolyzing] Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
B1XLR5 0.000557 45 28 2 101 3 guaA GMP synthase [glutamine-hydrolyzing] Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q3SQP4 0.00058 45 25 9 193 3 guaA GMP synthase [glutamine-hydrolyzing] Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
P49057 0.000583 45 28 5 118 3 guaA GMP synthase [glutamine-hydrolyzing] Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
C4Z3X1 0.000585 45 24 5 174 3 guaA GMP synthase [glutamine-hydrolyzing] Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
Q8FRZ3 0.0006 45 28 8 194 3 guaA GMP synthase [glutamine-hydrolyzing] Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q2S0V0 0.000623 45 26 7 184 3 guaA GMP synthase [glutamine-hydrolyzing] Salinibacter ruber (strain DSM 13855 / M31)
A6UVC9 0.000629 43 24 6 157 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Q02Y87 0.000703 45 23 6 177 3 guaA GMP synthase [glutamine-hydrolyzing] Lactococcus lactis subsp. cremoris (strain SK11)
Q9Z6H4 0.000721 45 23 6 177 3 guaA GMP synthase [glutamine-hydrolyzing] Lactococcus lactis subsp. cremoris (strain MG1363)
Q3MEA8 0.000737 45 30 4 106 3 guaA GMP synthase [glutamine-hydrolyzing] Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q3B0W1 0.000763 45 33 5 107 3 guaA GMP synthase [glutamine-hydrolyzing] Synechococcus sp. (strain CC9902)
B0S0S7 0.000779 45 22 4 173 3 guaA GMP synthase [glutamine-hydrolyzing] Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
O85192 0.000797 45 30 2 90 3 guaA GMP synthase [glutamine-hydrolyzing] Lacticaseibacillus rhamnosus
Q036Y5 0.000818 45 30 2 90 3 guaA GMP synthase [glutamine-hydrolyzing] Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3W952 0.000818 45 30 2 90 3 guaA GMP synthase [glutamine-hydrolyzing] Lacticaseibacillus casei (strain BL23)
P06558 0.000841 43 37 1 80 3 trpG Anthranilate synthase component 2 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A6UFA3 0.001 44 25 8 195 3 guaA GMP synthase [glutamine-hydrolyzing] Sinorhizobium medicae (strain WSM419)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS15500
Feature type CDS
Gene carA
Product glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit
Location 89771 - 90910 (strand: 1)
Length 1140 (nucleotides) / 379 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000005
Length 213534 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1187
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00117 Glutamine amidotransferase class-I
PF00988 Carbamoyl-phosphate synthase small chain, CPSase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0505 Amino acid transport and metabolism (E)
Nucleotide transport and metabolism (F)
EF Carbamoylphosphate synthase small subunit

Kegg Ortholog Annotation(s)

Protein Sequence

MFKSAILVLQDGTTFHGRAIGAEGTVTGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNTGTNSADEESSGVYAQGLVIRDLPLITSNFRSEENLSDYLKRHNVVAIADIDTRKLTRLLREKGAQNGCIIAGEHPDAALALANAQGFSGLNGLDLAKEVTTRQPYTWTQGSWTLEGGLPADKNTDELPFHVVAYDFGAKRNILRMLVDRGCRLTVVPAQTPAEEVLKMAPDGIFLSNGPGDPAPCDYAIDAIRSFLETDTPLFGICLGHQLLALASGAKTIKMKFGHHGGNHPVKDLEKSVVMITAQNHGFAVDEATLPDTLRVTHKSLFDGTLQGIHRNDKPAFSFQGHPEASPGPHDAAPLFDHFIELMKNARH

Flanking regions ( +/- flanking 50bp)

TATGAATTAATATGCATTAAATGTGATTTATTATTCTTCCGGAGGGTGTTTTGTTTAAGTCAGCGATCCTGGTTCTGCAAGACGGAACCACATTTCACGGGCGCGCTATCGGCGCTGAGGGAACCGTCACCGGTGAAGTTGTTTTTAATACCTCGATGACGGGGTATCAGGAAATTCTTACCGACCCCTCTTATTCCCGCCAGATAGTCACTCTCACTTATCCCCATATCGGCAATACCGGCACTAACAGTGCTGATGAAGAATCCTCAGGTGTTTATGCTCAGGGTCTGGTAATCCGCGACCTGCCGCTGATCACCAGCAATTTCCGCAGTGAAGAGAACCTGTCTGATTACCTGAAACGCCACAATGTGGTGGCCATTGCTGATATCGACACCCGTAAACTGACCCGTCTACTGCGCGAAAAAGGCGCACAGAACGGCTGTATTATTGCCGGAGAACACCCGGACGCCGCACTGGCGCTGGCGAACGCACAGGGTTTCAGTGGTCTGAACGGACTGGATTTGGCGAAAGAAGTTACAACCCGTCAGCCGTACACCTGGACTCAGGGTTCATGGACATTGGAAGGTGGTCTGCCTGCGGATAAAAACACAGATGAACTGCCGTTTCATGTTGTGGCATACGATTTCGGAGCTAAACGCAATATTCTGCGGATGTTGGTGGACAGAGGTTGCCGACTGACCGTTGTCCCGGCACAGACCCCGGCGGAAGAGGTGCTGAAAATGGCACCGGACGGTATTTTCCTCTCCAACGGTCCGGGTGACCCGGCACCGTGTGACTATGCTATTGACGCTATCCGCAGCTTCTTAGAAACCGATACTCCGCTGTTCGGCATCTGTCTGGGACACCAGTTACTGGCGCTCGCCAGTGGTGCAAAAACCATCAAAATGAAATTTGGTCACCACGGCGGTAACCATCCGGTCAAAGATCTTGAAAAGAGTGTGGTGATGATCACCGCGCAAAACCACGGTTTTGCCGTAGATGAAGCAACATTGCCCGATACGCTGCGTGTGACACATAAATCACTGTTTGACGGCACATTGCAGGGCATTCACCGCAATGATAAACCGGCATTCAGCTTCCAGGGACATCCGGAAGCCAGCCCCGGCCCGCATGATGCCGCACCGCTGTTCGACCACTTTATTGAGTTGATGAAAAACGCCCGTCACTAATCAGGAGCAGGAAAAATGGCAAAACGTACTGATATTAAAAGCATCCTGAT