Homologs in group_1125

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06425 FBDBKF_06425 100.0 Morganella morganii S1 carA carbamoyl phosphate synthase small subunit
EHELCC_09470 EHELCC_09470 100.0 Morganella morganii S2 carA carbamoyl phosphate synthase small subunit
NLDBIP_09850 NLDBIP_09850 100.0 Morganella morganii S4 carA carbamoyl phosphate synthase small subunit
LHKJJB_07905 LHKJJB_07905 100.0 Morganella morganii S3 carA carbamoyl phosphate synthase small subunit
F4V73_RS15500 F4V73_RS15500 93.9 Morganella psychrotolerans carA glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit
PMI_RS00100 PMI_RS00100 79.9 Proteus mirabilis HI4320 carA glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit

Distribution of the homologs in the orthogroup group_1125

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1125

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A6F1 0.0 682 85 0 378 1 carA Carbamoyl phosphate synthase small chain Escherichia coli (strain K12)
P0A6F2 0.0 682 85 0 378 3 carA Carbamoyl phosphate synthase small chain Escherichia coli O157:H7
Q8FLB1 0.0 681 85 0 378 3 carA Carbamoyl phosphate synthase small chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P14845 0.0 674 84 0 379 3 carA Carbamoyl phosphate synthase small chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z9L8 0.0 674 84 0 378 3 carA Carbamoyl phosphate synthase small chain Salmonella typhi
Q6D0C8 0.0 659 82 0 378 3 carA Carbamoyl phosphate synthase small chain Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7N8W2 0.0 650 80 1 384 3 carA Carbamoyl phosphate synthase small chain Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q66ER8 0.0 641 81 0 378 3 carA Carbamoyl phosphate synthase small chain Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZIL5 0.0 641 81 0 378 3 carA Carbamoyl phosphate synthase small chain Yersinia pestis
Q9KPH8 0.0 629 78 0 378 3 carA Carbamoyl phosphate synthase small chain Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8DEM1 0.0 628 78 0 376 3 carA Carbamoyl phosphate synthase small chain Vibrio vulnificus (strain CMCP6)
Q7MNU1 0.0 627 78 0 376 3 carA Carbamoyl phosphate synthase small chain Vibrio vulnificus (strain YJ016)
Q87SF4 0.0 625 78 0 375 3 carA Carbamoyl phosphate synthase small chain Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6LUK6 0.0 620 78 0 375 3 carA Carbamoyl phosphate synthase small chain Photobacterium profundum (strain SS9)
Q8EHS6 0.0 590 74 0 379 3 carA Carbamoyl phosphate synthase small chain Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q6F8M7 0.0 557 70 3 382 3 carA Carbamoyl phosphate synthase small chain Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
C5BQ30 0.0 553 71 2 371 3 carA Carbamoyl phosphate synthase small chain Teredinibacter turnerae (strain ATCC 39867 / T7901)
P38098 0.0 553 70 0 378 3 carA Carbamoyl phosphate synthase small chain Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8RSS4 0.0 551 69 3 384 3 carA Carbamoyl phosphate synthase small chain Halomonas eurihalina
B8GNX4 0.0 549 70 3 375 3 carA Carbamoyl phosphate synthase small chain Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
P57245 0.0 539 67 0 370 3 carA Carbamoyl phosphate synthase small chain Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q87WP3 0.0 538 67 0 378 3 carA Carbamoyl phosphate synthase small chain Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88DU5 0.0 535 68 0 378 3 carA Carbamoyl phosphate synthase small chain Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P38099 0.0 532 68 0 370 3 carA Carbamoyl phosphate synthase small chain Stutzerimonas stutzeri
Q9JVZ6 0.0 514 65 1 378 3 carA Carbamoyl phosphate synthase small chain Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q8K9Z6 0.0 514 64 0 374 3 carA Carbamoyl phosphate synthase small chain Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9JXX4 0.0 513 65 1 378 3 carA Carbamoyl phosphate synthase small chain Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9CKV3 0.0 511 65 2 377 3 carA Carbamoyl phosphate synthase small chain Pasteurella multocida (strain Pm70)
Q50983 3.61e-179 505 64 1 379 3 carA Carbamoyl phosphate synthase small chain Neisseria gonorrhoeae
A4SXM1 3e-177 501 63 3 386 3 carA Carbamoyl phosphate synthase small chain Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q8XZ85 3.39e-177 500 64 3 379 3 carA Carbamoyl phosphate synthase small chain Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
P58895 6.35e-177 500 62 3 388 3 carA Carbamoyl phosphate synthase small chain Xanthomonas axonopodis pv. citri (strain 306)
P58896 1.8e-175 496 62 2 378 3 carA Carbamoyl phosphate synthase small chain Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B1XUM3 1.16e-172 489 62 4 385 3 carA Carbamoyl phosphate synthase small chain Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q9PEC2 5.34e-172 487 62 3 375 3 carA Carbamoyl phosphate synthase small chain Xylella fastidiosa (strain 9a5c)
Q87EB9 8e-172 486 63 3 375 3 carA Carbamoyl phosphate synthase small chain Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9JP87 9.37e-172 487 63 3 378 3 carA Carbamoyl phosphate synthase small chain Rubrivivax gelatinosus (strain NBRC 100245 / IL144)
Q7VP66 1e-169 482 60 5 389 3 carA Carbamoyl phosphate synthase small chain Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P59576 1.23e-159 456 56 1 375 3 carA Carbamoyl phosphate synthase small chain Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A1UTE8 2.35e-132 387 53 6 381 3 carA Carbamoyl phosphate synthase small chain Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q3A450 1.62e-131 384 53 3 376 3 carA Carbamoyl phosphate synthase small chain Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q5LTN6 5.14e-131 384 51 6 379 3 carA Carbamoyl phosphate synthase small chain Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A6WZJ5 5.87e-131 384 53 6 384 3 carA Carbamoyl phosphate synthase small chain Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q8D3H7 9.05e-131 382 48 3 382 3 carA Carbamoyl phosphate synthase small chain Wigglesworthia glossinidia brevipalpis
Q6YV23 1.72e-128 379 49 4 380 2 CARA Carbamoyl phosphate synthase small chain, chloroplastic Oryza sativa subsp. japonica
B4S5S1 4.96e-128 375 49 3 379 3 carA Carbamoyl phosphate synthase small chain Prosthecochloris aestuarii (strain DSM 271 / SK 413)
B0CHS0 2.39e-127 375 52 6 383 3 carA Carbamoyl phosphate synthase small chain Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8FZJ8 2.75e-127 375 52 6 383 3 carA Carbamoyl phosphate synthase small chain Brucella suis biovar 1 (strain 1330)
A9M6F1 2.75e-127 375 52 6 383 3 carA Carbamoyl phosphate synthase small chain Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q6FZ66 7.07e-127 373 50 4 382 3 carA Carbamoyl phosphate synthase small chain Bartonella quintana (strain Toulouse)
A5VRM1 1.06e-126 373 52 6 383 3 carA Carbamoyl phosphate synthase small chain Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YIB8 1.06e-126 373 52 6 383 3 carA Carbamoyl phosphate synthase small chain Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0REC2 1.06e-126 373 52 6 383 3 carA Carbamoyl phosphate synthase small chain Brucella melitensis biotype 2 (strain ATCC 23457)
Q57C28 1.06e-126 373 52 6 383 3 carA Carbamoyl phosphate synthase small chain Brucella abortus biovar 1 (strain 9-941)
Q2YM22 1.06e-126 373 52 6 383 3 carA Carbamoyl phosphate synthase small chain Brucella abortus (strain 2308)
B2S6U9 1.06e-126 373 52 6 383 3 carA Carbamoyl phosphate synthase small chain Brucella abortus (strain S19)
Q98IA7 6.38e-126 371 52 5 384 3 carA Carbamoyl phosphate synthase small chain Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q89DR8 7.1e-126 370 50 5 382 3 carA Carbamoyl phosphate synthase small chain Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A9IWF8 9.64e-126 370 50 4 382 3 carA Carbamoyl phosphate synthase small chain Bartonella tribocorum (strain CIP 105476 / IBS 506)
O50235 1.12e-125 369 50 5 376 3 carA Carbamoyl phosphate synthase small chain Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q92N95 4.84e-125 369 51 5 383 3 carA Carbamoyl phosphate synthase small chain Rhizobium meliloti (strain 1021)
Q6G5M0 6.77e-125 368 50 6 385 3 carA Carbamoyl phosphate synthase small chain Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q7UGJ6 1.15e-124 367 51 4 377 3 carA Carbamoyl phosphate synthase small chain Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q8KGA2 8.5e-124 364 50 4 377 3 carA Carbamoyl phosphate synthase small chain Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8UDF7 4.63e-123 363 50 6 384 3 carA Carbamoyl phosphate synthase small chain Agrobacterium fabrum (strain C58 / ATCC 33970)
Q31LB7 3.42e-122 361 51 7 379 3 carA Carbamoyl phosphate synthase small chain Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q9LVW7 8.16e-122 362 48 4 379 1 CARA Carbamoyl phosphate synthase small chain, chloroplastic Arabidopsis thaliana
Q9A4J7 1.68e-121 359 49 6 385 3 carA Carbamoyl phosphate synthase small chain Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q5N0L0 4.51e-121 358 51 7 379 3 carA Carbamoyl phosphate synthase small chain Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P74587 1.23e-120 357 49 5 379 3 carA Carbamoyl phosphate synthase small chain Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P51201 7.23e-120 355 48 7 382 3 carA Carbamoyl phosphate synthase small chain Porphyra purpurea
Q8DKU5 2.11e-118 351 50 5 383 3 carA Carbamoyl phosphate synthase small chain Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
O66727 1.5e-116 346 47 3 373 3 carA Carbamoyl phosphate synthase small chain Aquifex aeolicus (strain VF5)
Q8YXQ7 2.11e-115 343 48 3 376 3 carA Carbamoyl phosphate synthase small chain Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q1XDT6 8.16e-114 339 46 6 381 3 carA Carbamoyl phosphate synthase small chain Neopyropia yezoensis
Q8F6R2 1.18e-112 336 47 5 375 3 carA Carbamoyl phosphate synthase small chain Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PK5 7.28e-112 334 46 5 375 3 carA Carbamoyl phosphate synthase small chain Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q04ZG6 1.9e-111 333 46 5 376 3 carA Carbamoyl phosphate synthase small chain Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04R57 1.9e-111 333 46 5 376 3 carA Carbamoyl phosphate synthase small chain Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q7U7F9 7.62e-111 332 48 7 380 3 carA Carbamoyl phosphate synthase small chain Parasynechococcus marenigrum (strain WH8102)
B2URJ0 1.97e-109 328 46 4 375 3 carA Carbamoyl phosphate synthase small chain Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
Q9RWI4 3.51e-109 328 46 6 383 3 carA Carbamoyl phosphate synthase small chain Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q1IWN0 1.08e-107 324 46 6 383 3 carA Carbamoyl phosphate synthase small chain Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q8Y664 1.17e-107 323 47 6 370 3 carA Carbamoyl phosphate synthase small chain Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q5SLL3 1.49e-107 324 45 6 380 3 carA Carbamoyl phosphate synthase small chain Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72GZ0 1.49e-107 324 45 6 380 3 carA Carbamoyl phosphate synthase small chain Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q71YI0 1.74e-106 320 47 6 370 3 carA Carbamoyl phosphate synthase small chain Listeria monocytogenes serotype 4b (strain F2365)
Q9K9V8 1.8e-106 320 46 6 376 3 pyrAA Carbamoyl phosphate synthase pyrimidine-specific small chain Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8CXH8 5.15e-106 319 46 6 383 3 carA Carbamoyl phosphate synthase small chain Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P52557 1.39e-105 318 47 6 371 3 carA Carbamoyl phosphate synthase small chain Bacillus caldolyticus
Q0BY73 2.36e-105 318 47 5 381 3 carA Carbamoyl phosphate synthase small chain Hyphomonas neptunium (strain ATCC 15444)
Q0AMR3 2.96e-105 318 45 6 377 3 carA Carbamoyl phosphate synthase small chain Maricaulis maris (strain MCS10)
Q92AH2 3.49e-105 317 47 6 370 3 carA Carbamoyl phosphate synthase small chain Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q7VHS5 2.73e-104 315 43 5 378 3 carA Carbamoyl phosphate synthase small chain Helicobacter hepaticus (strain ATCC 51449 / 3B1)
C6C0A9 3.26e-104 315 45 6 378 3 carA Carbamoyl phosphate synthase small chain Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q5HPY9 3.72e-104 314 44 6 380 3 carA Carbamoyl phosphate synthase small chain Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
C4XRH8 3.87e-104 315 44 5 376 3 carA Carbamoyl phosphate synthase small chain Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q8RG87 9.1e-104 313 46 4 371 3 carA Carbamoyl phosphate synthase small chain Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q4L5Q4 9.27e-104 313 45 6 381 3 carA Carbamoyl phosphate synthase small chain Staphylococcus haemolyticus (strain JCSC1435)
Q9KXR5 1.03e-103 313 45 4 381 3 carA Carbamoyl phosphate synthase small chain Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q6HES7 1.27e-103 313 47 7 376 3 carA Carbamoyl phosphate synthase small chain Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81WF1 1.27e-103 313 47 7 376 3 carA Carbamoyl phosphate synthase small chain Bacillus anthracis
Q827Q8 1.57e-103 313 45 4 381 3 carA Carbamoyl phosphate synthase small chain Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
O28995 2.82e-103 311 46 4 376 3 carA Carbamoyl phosphate synthase small chain Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q819S2 2.84e-103 312 47 7 376 3 carA Carbamoyl phosphate synthase small chain Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P63734 3.35e-103 311 44 3 370 3 carA Carbamoyl phosphate synthase small chain Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P63733 3.35e-103 311 44 3 370 3 carA Carbamoyl phosphate synthase small chain Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q732I2 3.45e-103 311 47 7 376 3 carA Carbamoyl phosphate synthase small chain Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6B940 3.52e-103 313 43 6 378 3 carA Carbamoyl phosphate synthase small chain Gracilaria tenuistipitata var. liui
Q8CPJ5 4.11e-103 311 44 6 380 3 carA Carbamoyl phosphate synthase small chain Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P77885 5.63e-103 311 46 5 369 3 pyrAA Carbamoyl phosphate synthase pyrimidine-specific small chain Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P25993 6.85e-103 311 48 6 372 1 pyrAA Carbamoyl phosphate synthase pyrimidine-specific small chain Bacillus subtilis (strain 168)
Q9WZ28 8.15e-103 311 44 6 413 3 carA Carbamoyl phosphate synthase small chain Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9CF80 8.26e-103 310 43 5 377 3 carA Carbamoyl phosphate synthase small chain Lactococcus lactis subsp. lactis (strain IL1403)
Q636D9 1.09e-102 310 47 7 376 3 carA Carbamoyl phosphate synthase small chain Bacillus cereus (strain ZK / E33L)
Q6NH15 2.03e-102 310 45 7 384 3 carA Carbamoyl phosphate synthase small chain Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A5GTM5 2.69e-102 310 44 8 382 3 carA Carbamoyl phosphate synthase small chain Synechococcus sp. (strain RCC307)
Q49WY3 6.07e-102 308 42 6 383 3 carA Carbamoyl phosphate synthase small chain Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9L4N5 6.72e-102 308 43 5 374 3 carA Carbamoyl phosphate synthase small chain Lactococcus lactis subsp. cremoris (strain MG1363)
P63730 9.89e-102 308 44 7 386 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain MW2)
Q6GA11 9.89e-102 308 44 7 386 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain MSSA476)
P99147 9.89e-102 308 44 7 386 1 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain N315)
P63729 9.89e-102 308 44 7 386 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGN0 9.89e-102 308 44 7 386 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain COL)
Q6GHN3 1.16e-101 308 44 7 386 3 carA Carbamoyl phosphate synthase small chain Staphylococcus aureus (strain MRSA252)
Q8XHB2 1.38e-101 307 44 6 369 3 carA Carbamoyl phosphate synthase small chain Clostridium perfringens (strain 13 / Type A)
P0DA13 3.35e-101 306 43 5 373 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M3 (strain SSI-1)
Q5XCR8 3.35e-101 306 43 5 373 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DA12 3.35e-101 306 43 5 373 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P63735 3.35e-101 306 43 5 373 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M1
Q8FT41 6.74e-101 307 46 7 381 3 carA Carbamoyl phosphate synthase small chain Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P58894 1.3e-100 305 43 5 373 3 carA Carbamoyl phosphate synthase small chain Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q67Q55 2.74e-100 304 45 4 373 3 carA Carbamoyl phosphate synthase small chain Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A1VA26 7.3e-100 303 44 6 377 3 carA Carbamoyl phosphate synthase small chain Nitratidesulfovibrio vulgaris (strain DP4)
Q726J4 7.3e-100 303 44 6 377 1 carA Carbamoyl phosphate synthase small chain Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q8DUP4 1.49e-99 302 43 5 369 3 carA Carbamoyl phosphate synthase small chain Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P63732 3.57e-99 301 42 4 371 3 carA Carbamoyl phosphate synthase small chain Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P63731 3.57e-99 301 42 4 371 3 carA Carbamoyl phosphate synthase small chain Streptococcus agalactiae serotype III (strain NEM316)
B3DQ31 5.14e-99 302 43 6 393 3 carA Carbamoyl phosphate synthase small chain Bifidobacterium longum (strain DJO10A)
Q97FT2 5.23e-99 300 42 7 370 3 carA Carbamoyl phosphate synthase small chain Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8G816 7.85e-99 302 43 5 392 3 carA Carbamoyl phosphate synthase small chain Bifidobacterium longum (strain NCC 2705)
B7GPW1 1.66e-98 301 43 5 392 3 carA Carbamoyl phosphate synthase small chain Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q58425 8.21e-97 295 43 6 373 3 carA Carbamoyl phosphate synthase small chain Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8KZA0 1.52e-96 295 44 6 376 3 carA Carbamoyl phosphate synthase small chain Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
O19886 3.99e-96 295 42 7 390 3 carA Carbamoyl phosphate synthase small chain Cyanidium caldarium
P58893 2.33e-95 293 46 9 384 3 carA Carbamoyl phosphate synthase small chain Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q9PMG8 7.91e-95 291 39 5 376 3 carA Carbamoyl phosphate synthase small chain Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P9WPK5 6.65e-94 288 44 5 386 1 carA Carbamoyl phosphate synthase small chain Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPK4 6.65e-94 288 44 5 386 3 carA Carbamoyl phosphate synthase small chain Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7U055 8e-94 288 44 5 386 3 carA Carbamoyl phosphate synthase small chain Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q6LWW5 1.59e-93 287 41 5 378 3 carA Carbamoyl phosphate synthase small chain Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
A6VHH7 1.77e-93 287 41 5 378 3 carA Carbamoyl phosphate synthase small chain Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
A4G0Y3 1.87e-93 287 41 6 378 3 carA Carbamoyl phosphate synthase small chain Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
A9A972 8.51e-93 285 41 5 378 3 carA Carbamoyl phosphate synthase small chain Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
Q8TY15 3.95e-92 283 42 4 376 3 carA Carbamoyl phosphate synthase small chain Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q8RBK1 5.68e-92 283 43 6 369 3 carA Carbamoyl phosphate synthase small chain Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q741H2 1.14e-90 280 43 7 391 3 carA Carbamoyl phosphate synthase small chain Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q17VI1 3.74e-90 279 41 7 383 3 carA Carbamoyl phosphate synthase small chain Helicobacter acinonychis (strain Sheeba)
Q9ZJY9 1.09e-88 275 41 7 376 3 carA Carbamoyl phosphate synthase small chain Helicobacter pylori (strain J99 / ATCC 700824)
Q8TNY3 3.08e-88 273 41 5 367 3 carA Carbamoyl phosphate synthase small chain Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
B8IZS6 4.11e-88 273 42 8 384 3 carA Carbamoyl phosphate synthase small chain Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
O27079 1.1e-87 272 41 4 371 3 carA Carbamoyl phosphate synthase small chain Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q9CCR3 1.35e-87 272 42 7 389 3 carA Carbamoyl phosphate synthase small chain Mycobacterium leprae (strain TN)
Q8Q0U4 2.26e-87 271 41 5 367 3 carA Carbamoyl phosphate synthase small chain Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
O25835 2.82e-87 271 40 7 379 3 carA Carbamoyl phosphate synthase small chain Helicobacter pylori (strain ATCC 700392 / 26695)
Q6BJG4 4.61e-87 273 41 7 386 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q6C9Y4 3.95e-86 271 40 6 389 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Yarrowia lipolytica (strain CLIB 122 / E 150)
Q2H132 1.24e-85 270 40 6 378 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
Q1MPN3 4.29e-85 266 41 8 382 3 carA Carbamoyl phosphate synthase small chain Lawsonia intracellularis (strain PHE/MN1-00)
A6UQN4 1.06e-84 265 39 6 379 3 carA Carbamoyl phosphate synthase small chain Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q5AML6 1.25e-83 264 40 5 380 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Candida albicans (strain SC5314 / ATCC MYA-2876)
P87183 1.47e-82 262 40 6 384 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Hypocrea virens
P22572 2.6e-82 261 40 7 374 1 arg-2 Carbamoyl phosphate synthase arginine-specific small chain Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
A1CZ92 2.65e-81 258 39 5 386 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Q4WU09 3.81e-81 258 39 5 386 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
O60060 5.39e-80 254 39 6 379 3 arg5 Carbamoyl phosphate synthase arginine-specific small chain Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q5BB37 8.27e-80 254 38 5 387 2 cpa-1 Carbamoyl phosphate synthase arginine-specific small chain Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A2R9B9 1.67e-79 254 39 6 388 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
A1CA18 1.88e-79 254 39 5 386 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
Q0U5H7 2.13e-79 254 36 6 387 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
Q6CIQ1 3.95e-79 251 39 9 381 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q2U913 6.99e-79 252 38 5 386 3 cpa1 Carbamoyl phosphate synthase arginine-specific small chain Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q1DUF5 1.44e-78 252 38 6 385 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Coccidioides immitis (strain RS)
Q9K8V6 2.57e-78 248 38 5 369 3 carA Carbamoyl phosphate synthase arginine-specific small chain Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P54324 4.38e-78 247 38 6 373 1 carA Carbamoyl phosphate synthase arginine-specific small chain Geobacillus stearothermophilus
O08317 5.35e-76 242 40 8 368 2 carA Carbamoyl phosphate synthase arginine-specific small chain Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P36838 1.78e-75 240 38 8 376 3 carA Carbamoyl phosphate synthase arginine-specific small chain Bacillus subtilis (strain 168)
P07258 1.85e-75 242 38 7 383 1 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8U086 7.77e-75 239 36 7 386 3 carA Carbamoyl phosphate synthase small chain Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q8ZY49 3.4e-74 237 38 9 373 3 carA Carbamoyl phosphate synthase small chain Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
B2RQC6 2e-71 246 40 7 385 1 Cad Multifunctional protein CAD Mus musculus
Q6FQ30 5.01e-71 230 37 9 382 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
P20054 9.3e-71 244 37 8 387 1 pyr1-3 Multifunctional protein pyr1-3 Dictyostelium discoideum
O93937 1.15e-70 244 38 8 394 3 pyrABCN Multifunctional protein pyrABCN Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q18990 1.6e-70 243 37 7 389 1 pyr-1 Multifunctional protein pyr-1 Caenorhabditis elegans
Q91437 3.85e-70 242 39 7 386 2 CAD Multifunctional protein CAD Squalus acanthias
P08955 1.66e-69 240 39 7 385 1 CAD Multifunctional protein CAD Mesocricetus auratus
P27708 1.12e-68 238 38 8 385 1 CAD Multifunctional protein CAD Homo sapiens
Q09794 3.85e-68 236 36 8 400 1 ura1 Multifunctional protein ura1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q752N9 9.75e-68 222 36 9 394 3 CPA1 Carbamoyl phosphate synthase arginine-specific small chain Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
P31327 2.61e-67 234 37 8 389 1 CPS1 Carbamoyl-phosphate synthase [ammonia], mitochondrial Homo sapiens
Q8C196 3.54e-66 231 37 8 389 1 Cps1 Carbamoyl-phosphate synthase [ammonia], mitochondrial Mus musculus
Q7S8A6 4.5e-66 230 36 8 395 1 pyr-3 Multifunctional protein pyr-3 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P07756 7.63e-66 229 37 8 389 1 Cps1 Carbamoyl-phosphate synthase [ammonia], mitochondrial Rattus norvegicus
P07259 1.68e-65 229 36 8 402 1 URA2 Multifunctional protein URA2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q970U8 9.43e-64 211 34 9 386 3 carA Carbamoyl phosphate synthase small chain Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
A4YI77 1.54e-63 210 32 5 381 3 carA Carbamoyl phosphate synthase small chain Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
Q91293 1.59e-63 223 36 7 389 2 None Carbamoyl-phosphate synthase [ammonia], mitochondrial Aquarana catesbeiana
P05990 2.34e-63 223 37 7 389 1 r Multifunctional protein r Drosophila melanogaster
Q59968 4.12e-62 206 33 8 385 3 carA Carbamoyl phosphate synthase small chain Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q9HP42 1.18e-58 197 35 9 377 3 carA Carbamoyl phosphate synthase small chain Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R6F1 1.18e-58 197 35 9 377 3 carA Carbamoyl phosphate synthase small chain Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q4J8E9 1.96e-57 194 32 8 382 3 carA Carbamoyl phosphate synthase small chain Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q97AJ4 6.93e-56 189 36 12 364 3 carA Carbamoyl phosphate synthase small chain Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q9HK16 8.87e-49 171 33 11 365 3 carA Carbamoyl phosphate synthase small chain Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q9YGB2 6.57e-15 75 30 4 172 3 trpG Anthranilate synthase component 2 Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q08654 1.01e-14 79 30 6 162 3 trpGD Bifunctional protein TrpGD Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q57690 4.5e-14 73 29 4 181 3 trpG Anthranilate synthase component 2 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P15395 1.93e-12 72 32 5 149 4 trpE(G) Anthranilate synthase Rhizobium meliloti (strain 1021)
P28819 2.16e-12 68 28 4 160 2 pabA Aminodeoxychorismate/anthranilate synthase component 2 Bacillus subtilis (strain 168)
P26922 3.81e-12 68 30 3 145 1 trpG Anthranilate synthase component 2 Azospirillum brasilense
Q5V632 1.47e-10 63 32 3 138 3 trpG2 Anthranilate synthase component II Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q1XDC5 3.88e-10 62 24 2 135 4 trpG Anthranilate synthase component 2 Neopyropia yezoensis
Q0W700 3.91e-10 62 28 5 181 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
P51362 4.07e-10 62 29 3 136 4 trpG Anthranilate synthase component 2 Porphyra purpurea
Q8RDR4 4.93e-10 64 29 8 179 3 guaA GMP synthase [glutamine-hydrolyzing] Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8G5P4 1.12e-09 63 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Bifidobacterium longum (strain NCC 2705)
P06194 1.48e-09 60 29 4 155 3 pabA Aminodeoxychorismate synthase component 2 Klebsiella aerogenes
P20576 3.25e-09 59 28 4 142 1 trpG Anthranilate synthase component 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P48261 4.33e-09 59 27 7 160 3 trpG Anthranilate synthase component 2 Cyanophora paradoxa
P00902 4.48e-09 59 29 6 162 3 trpG Anthranilate synthase component 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P00901 5.19e-09 58 28 7 165 1 trpG Anthranilate synthase component 2 Pseudomonas putida
O59071 5.95e-09 58 36 3 94 1 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q06129 6.23e-09 58 28 4 138 1 trpG Anthranilate synthase component 2 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q5JFM4 7.35e-09 58 27 7 190 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q2NER5 7.54e-09 58 27 8 198 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q8PXF0 9.39e-09 58 31 5 161 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P06195 1.29e-08 57 27 4 154 3 pabA Aminodeoxychorismate synthase component 2 Serratia marcescens
Q46E00 1.36e-08 57 29 3 156 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanosarcina barkeri (strain Fusaro / DSM 804)
A8ETA7 1.47e-08 60 28 8 177 3 guaA GMP synthase [glutamine-hydrolyzing] Aliarcobacter butzleri (strain RM4018)
P9WN35 1.54e-08 58 28 2 129 1 trpG Anthranilate synthase component 2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN34 1.54e-08 58 28 2 129 3 trpG Anthranilate synthase component 2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O28949 1.55e-08 57 27 9 197 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P72539 1.55e-08 60 29 6 168 3 papA Aminodeoxychorismate synthase Streptomyces pristinaespiralis
Q12UJ5 1.85e-08 57 31 8 161 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
B2G994 1.91e-08 59 28 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLY3 1.91e-08 59 28 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Limosilactobacillus reuteri (strain DSM 20016)
P06193 2.08e-08 57 30 3 132 3 pabA Aminodeoxychorismate synthase component 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q47LQ0 2.26e-08 59 28 8 190 3 guaA GMP synthase [glutamine-hydrolyzing] Thermobifida fusca (strain YX)
A6TLR3 2.37e-08 59 28 6 175 3 guaA GMP synthase [glutamine-hydrolyzing] Alkaliphilus metalliredigens (strain QYMF)
Q31F66 2.55e-08 59 27 8 184 3 guaA GMP synthase [glutamine-hydrolyzing] Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q046I2 3.47e-08 58 27 6 173 3 guaA GMP synthase [glutamine-hydrolyzing] Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q42565 3.79e-08 57 27 5 165 1 ASB1 Anthranilate synthase beta subunit 1, chloroplastic Arabidopsis thaliana
Q9V0I6 3.96e-08 56 35 3 94 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Pyrococcus abyssi (strain GE5 / Orsay)
P32483 4.01e-08 58 33 7 151 3 pabAB Aminodeoxychorismate synthase Streptomyces griseus
P00937 4.99e-08 58 26 4 160 1 TRP3 Multifunctional tryptophan biosynthesis protein Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O28670 6.4e-08 55 29 8 155 3 trpG Anthranilate synthase component 2 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q04CA4 6.63e-08 57 33 2 104 3 guaA GMP synthase [glutamine-hydrolyzing] Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBU7 6.63e-08 57 33 2 104 3 guaA GMP synthase [glutamine-hydrolyzing] Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
B9MS76 6.7e-08 57 32 3 110 3 guaA GMP synthase [glutamine-hydrolyzing] Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q7XUS2 7.43e-08 57 27 6 166 1 ASB1 Anthranilate synthase beta subunit 1, chloroplastic Oryza sativa subsp. japonica
Q8U0R9 1.05e-07 55 32 3 94 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q65MU0 1.13e-07 57 28 7 173 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P71381 1.19e-07 55 30 8 164 3 trpG Anthranilate synthase component 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q02003 1.25e-07 55 26 5 148 3 trpG Anthranilate synthase component 2 Lactococcus lactis subsp. lactis (strain IL1403)
B2UZ05 1.38e-07 57 27 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain Alaska E43 / Type E3)
Q8THC7 1.56e-07 54 38 1 85 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
A4XKX8 1.6e-07 56 30 2 104 3 guaA GMP synthase [glutamine-hydrolyzing] Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q74LF7 1.89e-07 56 27 6 173 3 guaA GMP synthase [glutamine-hydrolyzing] Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
C0R5H8 2.49e-07 56 25 9 204 3 guaA GMP synthase [glutamine-hydrolyzing] Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q73IH1 2.49e-07 56 25 9 204 3 guaA GMP synthase [glutamine-hydrolyzing] Wolbachia pipientis wMel
A7GKG1 2.72e-07 55 27 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
P05379 2.78e-07 54 27 2 137 3 trpG Anthranilate synthase component 2 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
B7IUT1 2.87e-07 55 26 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain G9842)
P29727 2.98e-07 55 27 6 173 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus subtilis (strain 168)
Q9FJM5 3.12e-07 54 25 5 165 2 ASB2 Anthranilate synthase beta subunit 2, chloroplastic Arabidopsis thaliana
Q8Y822 3.24e-07 55 27 4 171 3 guaA GMP synthase [glutamine-hydrolyzing] Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
A6Q4N8 3.83e-07 55 29 9 188 3 guaA GMP synthase [glutamine-hydrolyzing] Nitratiruptor sp. (strain SB155-2)
A1AXH0 4.13e-07 55 26 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Ruthia magnifica subsp. Calyptogena magnifica
A0B5J1 4.32e-07 53 26 10 180 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
B2TIX3 4.59e-07 55 27 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium botulinum (strain Eklund 17B / Type B)
Q720X7 4.72e-07 55 26 4 171 3 guaA GMP synthase [glutamine-hydrolyzing] Listeria monocytogenes serotype 4b (strain F2365)
Q72IE5 4.78e-07 55 27 7 194 3 guaA GMP synthase [glutamine-hydrolyzing] Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q5SI28 5.71e-07 55 27 7 189 1 guaA GMP synthase [glutamine-hydrolyzing] Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q81IS3 6.21e-07 55 26 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q5FMD6 7.29e-07 54 27 8 186 3 guaA GMP synthase [glutamine-hydrolyzing] Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
B7H4Q8 9.22e-07 54 26 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain B4264)
Q5X4I9 9.69e-07 54 26 7 180 3 guaA GMP synthase [glutamine-hydrolyzing] Legionella pneumophila (strain Paris)
Q5WVX4 1.01e-06 54 26 7 180 3 guaA GMP synthase [glutamine-hydrolyzing] Legionella pneumophila (strain Lens)
Q92CU0 1.22e-06 53 28 6 173 3 guaA GMP synthase [glutamine-hydrolyzing] Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q7UFS3 1.22e-06 53 26 7 194 3 guaA GMP synthase [glutamine-hydrolyzing] Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
P20441 1.37e-06 52 27 5 161 3 trpG Anthranilate synthase component 2 Leptospira biflexa
P00903 1.42e-06 51 28 3 132 1 pabA Aminodeoxychorismate synthase component 2 Escherichia coli (strain K12)
O27693 1.55e-06 51 28 6 140 3 trpG Anthranilate synthase component 2 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
A5ICM2 1.62e-06 53 26 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Legionella pneumophila (strain Corby)
A7Z235 1.94e-06 53 28 7 174 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q0IE37 2.06e-06 53 27 7 171 3 guaA GMP synthase [glutamine-hydrolyzing] Synechococcus sp. (strain CC9311)
A9VQG9 2.29e-06 53 26 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus mycoides (strain KBAB4)
C5CBZ4 2.62e-06 53 26 7 182 3 guaA GMP synthase [glutamine-hydrolyzing] Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
A8FAH5 3.01e-06 52 33 2 92 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus pumilus (strain SAFR-032)
Q8LPN3 3.05e-06 53 32 5 118 1 ADCS Aminodeoxychorismate synthase, chloroplastic Arabidopsis thaliana
Q73ER7 3.37e-06 52 25 6 178 3 guaA GMP synthase [glutamine-hydrolyzing] Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8DGA5 3.52e-06 52 28 10 179 3 guaA GMP synthase [glutamine-hydrolyzing] Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q58970 4.09e-06 50 28 7 171 1 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A6QBI5 4.14e-06 52 29 8 175 3 guaA GMP synthase [glutamine-hydrolyzing] Sulfurovum sp. (strain NBC37-1)
Q979P8 4.25e-06 50 24 5 179 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
B7K8T7 4.37e-06 52 27 8 174 3 guaA GMP synthase [glutamine-hydrolyzing] Gloeothece citriformis (strain PCC 7424)
Q87BK6 4.44e-06 52 27 8 188 3 guaA GMP synthase [glutamine-hydrolyzing] Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6W2 4.44e-06 52 27 8 188 3 guaA GMP synthase [glutamine-hydrolyzing] Xylella fastidiosa (strain M23)
Q839J8 4.63e-06 52 34 3 103 3 guaA GMP synthase [glutamine-hydrolyzing] Enterococcus faecalis (strain ATCC 700802 / V583)
P26923 4.76e-06 50 27 6 166 3 trpG Anthranilate synthase component 2 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
B0U3R8 4.77e-06 52 27 7 182 3 guaA GMP synthase [glutamine-hydrolyzing] Xylella fastidiosa (strain M12)
Q2RGP2 5.36e-06 52 36 4 95 3 guaA GMP synthase [glutamine-hydrolyzing] Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A5N5D9 5.57e-06 52 22 4 186 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYY7 5.57e-06 52 22 4 186 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium kluyveri (strain NBRC 12016)
O26805 5.6e-06 50 25 6 165 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
C1CLE8 5.93e-06 52 29 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain P1031)
Q8DU81 6.02e-06 51 28 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q1J0T4 6.05e-06 51 26 8 202 3 guaA GMP synthase [glutamine-hydrolyzing] Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q6ASN4 7.19e-06 51 25 8 178 3 guaA GMP synthase [glutamine-hydrolyzing] Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
P00906 7.86e-06 49 27 4 144 4 trpG-TRPD Anthranilate synthase component II (Fragment) Shigella dysenteriae
A6SZM5 8.75e-06 51 26 6 180 3 guaA GMP synthase [glutamine-hydrolyzing] Janthinobacterium sp. (strain Marseille)
P24773 1.02e-05 51 24 5 182 3 trpC Multifunctional tryptophan biosynthesis protein Penicillium chrysogenum
Q764B9 1.04e-05 50 35 1 65 1 ASB2 Anthranilate synthase beta subunit 2, chloroplastic Oryza sativa subsp. japonica
Q756B7 1.25e-05 50 27 9 198 3 GUA1 GMP synthase [glutamine-hydrolyzing] Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q9KF78 1.41e-05 50 33 5 107 3 guaA Putative GMP synthase [glutamine-hydrolyzing] Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q83GZ6 1.44e-05 50 30 7 173 3 guaA GMP synthase [glutamine-hydrolyzing] Tropheryma whipplei (strain Twist)
Q5GSJ3 1.46e-05 50 25 7 197 3 guaA GMP synthase [glutamine-hydrolyzing] Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q38ZE1 1.49e-05 50 32 2 90 3 guaA GMP synthase [glutamine-hydrolyzing] Latilactobacillus sakei subsp. sakei (strain 23K)
Q4JTG0 1.68e-05 50 28 8 196 3 guaA GMP synthase [glutamine-hydrolyzing] Corynebacterium jeikeium (strain K411)
Q7NHC2 1.71e-05 50 30 2 101 3 guaA GMP synthase [glutamine-hydrolyzing] Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
C1CF29 1.78e-05 50 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain JJA)
B8ZKZ5 1.78e-05 50 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B2KCS8 1.83e-05 50 32 4 108 3 guaA GMP synthase [glutamine-hydrolyzing] Elusimicrobium minutum (strain Pei191)
B9KFL4 1.9e-05 50 29 4 117 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
P00904 2.02e-05 50 27 4 144 1 trpGD Bifunctional protein TrpGD Escherichia coli (strain K12)
P14952 2.11e-05 46 43 1 53 3 trpG Anthranilate synthase component 2 (Fragment) Acetivibrio thermocellus
C1CQS0 2.13e-05 50 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain Taiwan19F-14)
P64298 2.13e-05 50 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P64297 2.13e-05 50 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B1ICM9 2.13e-05 50 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain Hungary19A-6)
C1C842 2.13e-05 50 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain 70585)
B5E5U0 2.13e-05 50 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae serotype 19F (strain G54)
Q04JQ8 2.13e-05 50 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q891G7 2.24e-05 50 24 7 181 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium tetani (strain Massachusetts / E88)
B2IQR1 2.26e-05 50 28 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pneumoniae (strain CGSP14)
Q8CXK8 2.32e-05 50 33 3 106 3 guaA GMP synthase [glutamine-hydrolyzing] Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B3CPU7 2.38e-05 50 24 10 204 3 guaA GMP synthase [glutamine-hydrolyzing] Wolbachia pipientis subsp. Culex pipiens (strain wPip)
B7IHI2 2.41e-05 50 33 4 108 3 guaA GMP synthase [glutamine-hydrolyzing] Thermosipho africanus (strain TCF52B)
P06558 2.47e-05 48 40 1 80 3 trpG Anthranilate synthase component 2 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8RC63 2.65e-05 49 25 5 179 3 guaA GMP synthase [glutamine-hydrolyzing] Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q5ZUS0 2.76e-05 49 23 7 180 3 guaA GMP synthase [glutamine-hydrolyzing] Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
P06531 2.87e-05 49 24 6 184 2 trpC Multifunctional tryptophan biosynthesis protein Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A4G4U7 3e-05 49 26 7 181 3 guaA GMP synthase [glutamine-hydrolyzing] Herminiimonas arsenicoxydans
Q9PAR6 3e-05 49 27 8 188 3 guaA GMP synthase [glutamine-hydrolyzing] Xylella fastidiosa (strain 9a5c)
Q6TAS3 3.05e-05 49 25 7 179 1 ADCS Aminodeoxychorismate synthase, chloroplastic Solanum lycopersicum
Q83ID3 3.08e-05 49 29 7 173 3 guaA GMP synthase [glutamine-hydrolyzing] Tropheryma whipplei (strain TW08/27)
Q8YT80 3.11e-05 49 31 4 106 3 guaA GMP synthase [glutamine-hydrolyzing] Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
O66601 3.16e-05 49 26 7 179 3 guaA GMP synthase [glutamine-hydrolyzing] Aquifex aeolicus (strain VF5)
P20409 3.33e-05 49 24 3 160 3 trp1 Multifunctional tryptophan biosynthesis protein Phycomyces blakesleeanus
O25165 3.35e-05 49 32 2 85 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter pylori (strain ATCC 700392 / 26695)
A6LKY1 3.52e-05 49 32 4 104 3 guaA GMP synthase [glutamine-hydrolyzing] Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q18KM8 3.59e-05 47 26 4 161 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
A0AHK7 3.76e-05 49 27 6 173 3 guaA GMP synthase [glutamine-hydrolyzing] Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q30TH8 3.99e-05 49 26 6 175 3 guaA GMP synthase [glutamine-hydrolyzing] Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
B3ELI1 4.79e-05 48 29 8 181 3 guaA GMP synthase [glutamine-hydrolyzing] Chlorobium phaeobacteroides (strain BS1)
P05328 5.29e-05 48 25 4 165 3 trpC Multifunctional tryptophan biosynthesis protein Aspergillus niger
B2J9G3 5.36e-05 48 31 4 106 3 guaA GMP synthase [glutamine-hydrolyzing] Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
B8I4P0 5.85e-05 48 26 10 184 3 guaA GMP synthase [glutamine-hydrolyzing] Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
P00908 6.29e-05 48 25 3 164 3 trp-1 Multifunctional tryptophan biosynthesis protein Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q17YH9 6.95e-05 48 34 3 88 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter acinonychis (strain Sheeba)
C1D0M2 7.48e-05 48 25 8 202 3 guaA GMP synthase [glutamine-hydrolyzing] Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
B2UUF1 7.86e-05 48 32 2 85 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter pylori (strain Shi470)
O94277 7.89e-05 48 28 6 153 3 SPBP8B7.29 Putative aminodeoxychorismate synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A5UK20 7.9e-05 46 27 8 169 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
A2BTY4 8.15e-05 48 27 10 179 3 guaA GMP synthase [glutamine-hydrolyzing] Prochlorococcus marinus (strain MIT 9515)
Q5N2F8 8.94e-05 48 24 7 187 3 guaA GMP synthase [glutamine-hydrolyzing] Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
B1XLR5 9.15e-05 48 29 2 101 3 guaA GMP synthase [glutamine-hydrolyzing] Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
A3PA84 9.72e-05 48 26 9 181 3 guaA GMP synthase [glutamine-hydrolyzing] Prochlorococcus marinus (strain MIT 9301)
A0Q2S8 9.83e-05 48 30 3 96 3 guaA GMP synthase [glutamine-hydrolyzing] Clostridium novyi (strain NT)
Q82HM9 9.95e-05 48 25 7 195 3 guaA GMP synthase [glutamine-hydrolyzing] Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P60501 0.000109 47 25 7 190 3 guaA GMP synthase [glutamine-hydrolyzing] Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q5Z856 0.000119 48 36 3 91 2 ADCS Probable aminodeoxychorismate synthase, chloroplastic Oryza sativa subsp. japonica
Q9L0H2 0.00012 47 34 3 90 3 guaA GMP synthase [glutamine-hydrolyzing] Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
C4ZCQ4 0.000124 47 25 6 172 3 guaA GMP synthase [glutamine-hydrolyzing] Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q7NSG1 0.000125 47 31 4 105 3 guaA GMP synthase [glutamine-hydrolyzing] Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q3MEA8 0.000137 47 26 10 179 3 guaA GMP synthase [glutamine-hydrolyzing] Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q7VG78 0.000143 47 31 2 100 3 guaA Probable GMP synthase [glutamine-hydrolyzing] Helicobacter hepaticus (strain ATCC 51449 / 3B1)
P22101 0.000147 45 27 4 142 3 trpG Anthranilate synthase component 2 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P00905 0.000158 47 27 4 144 1 trpGD Bifunctional protein TrpGD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q2KDG7 0.000162 47 24 8 195 3 guaA GMP synthase [glutamine-hydrolyzing] Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q0AW22 0.000163 47 26 8 178 3 guaA GMP synthase [glutamine-hydrolyzing] Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
P0CL64 0.000166 47 25 7 176 3 guaA GMP synthase [glutamine-hydrolyzing] Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
B6IZE2 0.000173 47 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Coxiella burnetii (strain CbuG_Q212)
Q83BZ6 0.000176 47 30 3 102 1 guaA GMP synthase [glutamine-hydrolyzing] Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
B6J7Z4 0.000181 47 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Coxiella burnetii (strain CbuK_Q154)
Q9ZKG4 0.000191 47 31 2 85 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter pylori (strain J99 / ATCC 700824)
P49057 0.000191 47 26 10 180 3 guaA GMP synthase [glutamine-hydrolyzing] Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5L3E1 0.000195 47 32 7 153 3 guaA GMP synthase [glutamine-hydrolyzing] Geobacillus kaustophilus (strain HTA426)
Q1CSM2 0.000196 47 31 2 85 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter pylori (strain HPAG1)
Q3B0W1 0.0002 47 34 5 107 3 guaA GMP synthase [glutamine-hydrolyzing] Synechococcus sp. (strain CC9902)
Q5NN19 0.000205 47 30 3 103 3 guaA GMP synthase [glutamine-hydrolyzing] Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A9N8L6 0.000206 47 30 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Coxiella burnetii (strain RSA 331 / Henzerling II)
C3MCS5 0.000209 47 24 8 195 3 guaA GMP synthase [glutamine-hydrolyzing] Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B5Z842 0.000224 47 31 2 85 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter pylori (strain G27)
Q5WJI0 0.000244 46 33 4 107 3 guaA GMP synthase [glutamine-hydrolyzing] Shouchella clausii (strain KSM-K16)
O25868 0.000252 45 28 4 127 3 trpG Anthranilate synthase component 2 Helicobacter pylori (strain ATCC 700392 / 26695)
Q46I26 0.000253 46 27 10 193 3 guaA GMP synthase [glutamine-hydrolyzing] Prochlorococcus marinus (strain NATL2A)
Q1QKC3 0.000271 46 31 3 100 3 guaA GMP synthase [glutamine-hydrolyzing] Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
O19914 0.000295 45 25 5 135 4 trpG Anthranilate synthase component 2 Cyanidium caldarium
B9L0W3 0.000298 46 30 3 113 3 guaA GMP synthase [glutamine-hydrolyzing] Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
B6JMN5 0.000318 46 31 2 85 3 guaA GMP synthase [glutamine-hydrolyzing] Helicobacter pylori (strain P12)
Q3ITY2 0.00033 44 36 2 83 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
A2BZD9 0.000332 46 27 10 193 3 guaA GMP synthase [glutamine-hydrolyzing] Prochlorococcus marinus (strain NATL1A)
A2RED2 0.000344 46 30 2 93 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M5 (strain Manfredo)
Q9PKM3 0.000351 46 23 8 200 3 guaA GMP synthase [glutamine-hydrolyzing] Chlamydia muridarum (strain MoPn / Nigg)
E4QHI6 0.000354 46 33 5 105 3 guaA GMP synthase [glutamine-hydrolyzing] Borreliella burgdorferi (strain N40)
Q9HSH4 0.000362 44 25 7 152 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B3PYH7 0.000373 46 24 8 195 3 guaA GMP synthase [glutamine-hydrolyzing] Rhizobium etli (strain CIAT 652)
Q3ANK7 0.000378 46 34 5 107 3 guaA GMP synthase [glutamine-hydrolyzing] Synechococcus sp. (strain CC9605)
Q9ZJU6 0.000383 44 27 4 127 3 trpG Anthranilate synthase component 2 Helicobacter pylori (strain J99 / ATCC 700824)
A6VH31 0.000399 44 28 8 159 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
Q6MLD2 0.000424 45 27 10 195 3 guaA GMP synthase [glutamine-hydrolyzing] Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q036Y5 0.000443 45 31 2 90 3 guaA GMP synthase [glutamine-hydrolyzing] Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3W952 0.000443 45 31 2 90 3 guaA GMP synthase [glutamine-hydrolyzing] Lacticaseibacillus casei (strain BL23)
O85192 0.000447 45 31 2 90 3 guaA GMP synthase [glutamine-hydrolyzing] Lacticaseibacillus rhamnosus
P09575 0.000453 45 23 3 160 4 None Multifunctional tryptophan biosynthesis protein (Fragment) Pichia angusta
A4FW79 0.000504 44 27 7 145 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
A7I131 0.000507 45 24 8 179 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q1MMJ7 0.00052 45 28 4 109 3 guaA GMP synthase [glutamine-hydrolyzing] Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q7VEH5 0.000561 45 27 11 180 3 guaA GMP synthase [glutamine-hydrolyzing] Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q8NSR1 0.000584 45 28 8 192 3 guaA GMP synthase [glutamine-hydrolyzing] Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QBV0 0.000605 45 28 8 192 3 guaA GMP synthase [glutamine-hydrolyzing] Corynebacterium glutamicum (strain R)
B9JZA3 0.000625 45 24 9 196 3 guaA GMP synthase [glutamine-hydrolyzing] Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B5ZYE9 0.000631 45 28 3 103 3 guaA GMP synthase [glutamine-hydrolyzing] Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B2A5V5 0.000659 45 24 7 177 3 guaA GMP synthase [glutamine-hydrolyzing] Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
A9A9L8 0.000692 43 28 7 145 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
Q5M4P4 0.000736 45 31 3 94 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M029 0.000749 45 31 3 94 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus thermophilus (strain CNRZ 1066)
Q822V6 0.00076 45 22 8 205 3 guaA GMP synthase [glutamine-hydrolyzing] Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
A0RQD7 0.000799 45 31 3 95 3 guaA GMP synthase [glutamine-hydrolyzing] Campylobacter fetus subsp. fetus (strain 82-40)
Q1JLL1 0.000806 45 30 2 93 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBM8 0.000806 45 30 2 93 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M12 (strain MGAS2096)
B5XLN9 0.000835 45 30 2 93 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M49 (strain NZ131)
Q48TF6 0.000835 45 30 2 93 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1J6G5 0.000835 45 30 2 93 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M4 (strain MGAS10750)
P64300 0.000835 45 30 2 93 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M18 (strain MGAS8232)
P64299 0.000835 45 30 2 93 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M1
Q5XC20 0.000842 45 30 2 93 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q3Z886 0.000851 45 25 4 140 3 guaA GMP synthase [glutamine-hydrolyzing] Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
C4XSN8 0.000869 45 33 3 93 3 guaA GMP synthase [glutamine-hydrolyzing] Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q5V1K0 0.001 43 38 3 72 3 guaAA GMP synthase [glutamine-hydrolyzing] subunit A Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q1JGP6 0.001 45 30 2 93 3 guaA GMP synthase [glutamine-hydrolyzing] Streptococcus pyogenes serotype M2 (strain MGAS10270)
A9KGD5 0.001 44 29 3 102 3 guaA GMP synthase [glutamine-hydrolyzing] Coxiella burnetii (strain Dugway 5J108-111)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_07455
Feature type CDS
Gene carA
Product carbamoyl phosphate synthase small subunit
Location 92643 - 93782 (strand: 1)
Length 1140 (nucleotides) / 379 (amino acids)

Contig

Accession ZDB_684
Length 217237 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1125
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00117 Glutamine amidotransferase class-I
PF00988 Carbamoyl-phosphate synthase small chain, CPSase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0505 Amino acid transport and metabolism (E)
Nucleotide transport and metabolism (F)
EF Carbamoylphosphate synthase small subunit

Kegg Ortholog Annotation(s)

Protein Sequence

MFKSAILVLQDGTTFHGRAIGAEGAVTGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNTGTNSADEESPDVYAQGLVIRDLPLTTSNFRSEESLSEYLKRRNVVAIADIDTRKLTRLLREKGAQNGCIIAGEHPDTALALKNAQSFSGLNGLDLAKEVTTAQPYSWTQGSWTLEGGLPADKTAEELPFHVVAYDFGAKRNILRMLVDRGCRLTVVPAQTPAEEVLKMAPDGIFLSNGPGDPAPCDYAIEAITRFLETDIPLFGICLGHQLLALASGAKTIKMKFGHHGGNHPVKDIENNVVMITAQNHGFAVDEATLPATLRVTHKSLFDGTLQGIHRNDKPAFSFQGHPEASPGPHDAAPLFDHFIELMKNARH

Flanking regions ( +/- flanking 50bp)

TCTGAATTAATATGCACTAATTGTGATTTATTATTCCTCCGGAGGGTGTTTTGTTTAAGTCAGCAATCCTGGTTCTGCAAGACGGAACCACATTTCACGGACGCGCCATCGGCGCAGAGGGTGCCGTTACCGGCGAAGTTGTTTTTAATACCTCGATGACGGGGTATCAGGAAATTCTCACCGACCCCTCTTATTCCCGCCAGATAGTCACTCTCACTTATCCCCATATTGGTAATACCGGCACTAACAGTGCTGATGAAGAATCCCCGGATGTTTATGCACAAGGCCTCGTTATCCGCGACCTGCCGCTGACCACCAGTAATTTCCGCAGTGAAGAAAGCCTCTCCGAATACCTGAAACGCCGCAACGTCGTGGCTATCGCCGATATTGATACCCGCAAACTGACCCGCTTACTGCGCGAGAAAGGCGCTCAGAACGGCTGCATCATCGCCGGTGAGCACCCGGATACGGCACTGGCGCTGAAAAATGCACAGAGTTTCAGCGGGCTGAACGGGCTGGATCTGGCGAAAGAAGTCACCACCGCGCAGCCATACAGCTGGACGCAGGGCTCCTGGACACTGGAAGGCGGCTTACCGGCGGATAAAACAGCGGAAGAGCTGCCGTTCCATGTGGTGGCGTATGACTTCGGTGCCAAACGCAACATTCTGCGCATGCTGGTGGATCGCGGCTGCCGCCTGACCGTCGTACCGGCACAGACCCCGGCGGAAGAGGTGCTGAAAATGGCACCGGACGGTATTTTCCTCTCCAACGGCCCGGGTGACCCGGCACCGTGTGATTATGCGATTGAGGCTATCACCCGTTTCCTGGAAACCGATATTCCGTTGTTCGGCATCTGCCTGGGGCACCAGTTACTGGCACTCGCCAGCGGTGCAAAGACCATCAAAATGAAATTTGGTCACCACGGCGGCAACCACCCGGTTAAAGACATTGAAAATAATGTGGTGATGATTACCGCGCAGAACCACGGTTTTGCGGTGGATGAGGCGACGCTGCCCGCGACACTGCGCGTCACGCATAAGTCACTGTTTGACGGCACATTGCAGGGTATTCACCGCAATGATAAGCCTGCATTCAGCTTCCAGGGGCATCCTGAAGCCAGCCCGGGCCCGCACGACGCCGCCCCGCTGTTCGACCACTTTATTGAACTGATGAAAAACGCCCGTCACTGATCAGGAGCAGAAAAATGGCAAAACGTACAGATATCAGCAGCATCCTGATT