Homologs in group_458

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00630 FBDBKF_00630 100.0 Morganella morganii S1 fliN Flagellar motor switch/type III secretory pathway protein FliN
EHELCC_00915 EHELCC_00915 100.0 Morganella morganii S2 fliN Flagellar motor switch/type III secretory pathway protein FliN
LHKJJB_04060 LHKJJB_04060 100.0 Morganella morganii S3 fliN Flagellar motor switch/type III secretory pathway protein FliN
HKOGLL_02985 HKOGLL_02985 100.0 Morganella morganii S5 fliN Flagellar motor switch/type III secretory pathway protein FliN
F4V73_RS06640 F4V73_RS06640 91.9 Morganella psychrotolerans fliN flagellar motor switch protein FliN
PMI_RS08000 PMI_RS08000 75.4 Proteus mirabilis HI4320 fliN flagellar motor switch protein FliN

Distribution of the homologs in the orthogroup group_458

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_458

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P15070 4.08e-55 172 65 2 138 1 fliN Flagellar motor switch protein FliN Escherichia coli (strain K12)
P26419 4.4e-55 171 65 3 140 1 fliN Flagellar motor switch protein FliN Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P35539 3.33e-54 168 82 0 99 3 fliN Flagellar motor switch protein FliN (Fragment) Pectobacterium carotovorum subsp. carotovorum
Q51466 1.24e-30 110 59 0 83 3 fliN Flagellar motor switch protein FliN Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P24073 2.16e-26 104 49 2 99 3 fliY Flagellar motor switch phosphatase FliY Bacillus subtilis (strain 168)
Q44903 5.2e-25 94 54 0 75 3 fliN Flagellar motor switch protein FliN Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q89AZ3 4.92e-24 92 43 3 123 3 fliN Flagellar motor switch protein FliN Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P57183 6e-18 77 49 0 69 3 fliN Flagellar motor switch protein FliN Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q03593 4.72e-16 72 45 0 75 3 fliN Flagellar motor switch protein FliN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q57259 2.17e-13 66 36 1 77 3 fliN Flagellar motor switch protein FliN Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8KA38 1.59e-12 63 42 0 70 3 fliN Flagellar motor switch protein FliN Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
O54245 1.93e-12 64 35 1 77 3 fliN Flagellar motor switch protein FliN Rhizobium meliloti (strain 1021)
O67495 6.62e-10 56 31 0 100 3 fliN Flagellar motor switch protein FliN Aquifex aeolicus (strain VF5)
P40296 9.3e-05 43 30 3 109 1 yscQ Yop proteins translocation protein Q Yersinia pseudotuberculosis serotype I (strain IP32953)
P42713 9.3e-05 43 30 3 109 3 yscQ Yop proteins translocation protein Q Yersinia pestis
P74860 0.000603 41 30 0 65 3 ssaQ Secretion system apparatus protein SsaQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_02545
Feature type CDS
Gene fliN
Product Flagellar motor switch/type III secretory pathway protein FliN
Location 476683 - 477093 (strand: 1)
Length 411 (nucleotides) / 136 (amino acids)

Contig

Accession ZDB_519
Length 680340 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_458
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01052 Type III flagellar switch regulator (C-ring) FliN C-term

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1886 Cell motility (N)
Intracellular trafficking, secretion, and vesicular transport (U)
NU Flagellar motor switch/type III secretory pathway protein FliN

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02417 flagellar motor switch protein FliN Bacterial chemotaxis
Flagellar assembly
-

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG043115 flagellar motor switch protein FliN VF1154 Motility

Protein Sequence

MSEANNTPDMNPEHDGESLWAEAMEQQKKAETGNNQAFDNLDSQNPLNQLSDINLIMDIPVRLSVELGRTKMTIKKLLSLSQGSVVALDGLAGEPLDILINGYLIAQGEVVVVSDNYGIRITDIITPSERMRRLSR

Flanking regions ( +/- flanking 50bp)

GGAACATTTGATTAATCCTGTATTAAACACTCTGGACGAGGAAAAAACCAATGAGTGAGGCGAACAACACTCCTGATATGAACCCGGAACACGATGGCGAGTCTCTGTGGGCAGAGGCAATGGAACAACAAAAAAAAGCAGAAACCGGGAACAACCAGGCGTTTGATAATCTCGACAGCCAGAATCCGCTGAATCAGCTGTCTGATATCAATCTGATTATGGATATCCCTGTCCGTCTCTCTGTGGAACTGGGCCGGACAAAAATGACCATCAAGAAGCTGCTGAGTTTATCCCAGGGCTCGGTGGTGGCACTGGACGGGCTGGCCGGTGAACCGCTGGATATCCTGATCAATGGCTATCTGATTGCCCAGGGTGAAGTGGTGGTGGTCTCTGACAATTACGGTATCCGCATCACGGATATTATCACCCCGTCTGAACGTATGCGCCGCCTGAGCCGCTGATATGACACCGACCGCATCCGGCACCCCTGTTTTACCGGCCGCAGAGAAAA