Homologs in group_437

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00410 FBDBKF_00410 100.0 Morganella morganii S1 yfaE class I ribonucleotide reductase maintenance protein YfaE
EHELCC_01135 EHELCC_01135 100.0 Morganella morganii S2 yfaE class I ribonucleotide reductase maintenance protein YfaE
LHKJJB_03840 LHKJJB_03840 100.0 Morganella morganii S3 yfaE class I ribonucleotide reductase maintenance protein YfaE
HKOGLL_03205 HKOGLL_03205 100.0 Morganella morganii S5 yfaE class I ribonucleotide reductase maintenance protein YfaE
F4V73_RS06390 F4V73_RS06390 86.4 Morganella psychrotolerans yfaE class I ribonucleotide reductase maintenance protein YfaE
PMI_RS08520 PMI_RS08520 58.0 Proteus mirabilis HI4320 yfaE class I ribonucleotide reductase maintenance protein YfaE

Distribution of the homologs in the orthogroup group_437

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_437

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ABW3 5.47e-21 82 51 3 85 4 yfaE Uncharacterized ferredoxin-like protein YfaE Escherichia coli (strain K12)
P0ABW4 5.47e-21 82 51 3 85 4 yfaE Uncharacterized ferredoxin-like protein YfaE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45154 3.21e-19 77 52 2 75 4 HI_1309 Uncharacterized ferredoxin-like protein HI_1309 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P57274 1.66e-11 57 38 2 80 4 BU177 Uncharacterized ferredoxin-like protein BU177 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P00247 4.34e-09 52 31 3 93 1 None Ferredoxin Chlorogloeopsis fritschii
P0A3D3 6.98e-09 51 31 3 93 1 petF1 Ferredoxin-1 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P0A3D2 6.98e-09 51 31 3 93 3 petF Ferredoxin-1 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q89AS6 4.92e-08 48 32 3 90 4 bbp_166 Uncharacterized ferredoxin-like protein bbp_166 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q51577 6.81e-08 48 30 3 92 1 petF1 Ferredoxin-1 Leptolyngbya boryana
P00245 8.63e-08 48 29 3 93 1 None Ferredoxin Limnospira maxima
P75863 1.01e-07 50 47 2 55 1 ycbX Uncharacterized protein YcbX Escherichia coli (strain K12)
P51320 1.01e-07 48 31 3 92 3 petF Ferredoxin Porphyra purpurea
Q9C7Y4 3.48e-07 48 28 2 91 2 FDC2 Ferredoxin C 2, chloroplastic Arabidopsis thaliana
P00246 4.34e-07 47 29 3 93 1 None Ferredoxin Arthrospira platensis
P00248 5.8e-07 46 31 3 93 1 petF Ferredoxin Mastigocladus laminosus
P00221 6.06e-07 47 30 4 93 1 PETF Ferredoxin-1, chloroplastic Spinacia oleracea
Q1XDG7 6.19e-07 46 31 3 92 3 petF Ferredoxin Neopyropia yezoensis
P00244 1.04e-06 45 30 4 93 1 None Ferredoxin-1 Aphanizomenon flos-aquae
P04669 1.05e-06 46 29 2 92 2 PETF Ferredoxin, chloroplastic Silene latifolia subsp. alba
P00242 1.72e-06 45 31 3 89 1 PETF Ferredoxin Porphyra umbilicalis
P15788 2.15e-06 45 29 3 92 1 PCC7418_2938 Ferredoxin Halothece sp. (strain PCC 7418)
P00254 4.71e-06 44 29 3 93 1 petF1 Ferredoxin-1 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
P15789 4.73e-06 44 34 3 90 1 PETF Ferredoxin Cyanidium caldarium
O78510 5.1e-06 43 30 3 90 3 petF Ferredoxin Guillardia theta
P0A3C8 6.23e-06 43 29 3 93 1 petF Ferredoxin-1 Nostoc sp. (strain ATCC 29151 / PCC 7119)
P0A3C7 6.23e-06 43 29 3 93 1 petF Ferredoxin-1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q9TLW0 6.57e-06 43 30 3 92 3 petF Ferredoxin Cyanidium caldarium
P49522 1.69e-05 42 30 3 89 3 petF Ferredoxin Trieres chinensis
P00253 1.94e-05 42 27 3 93 1 None Ferredoxin Desmonostoc muscorum
P00224 1.95e-05 42 30 3 89 1 None Ferredoxin-2 Spinacia oleracea
P00252 2.05e-05 42 31 4 90 1 None Ferredoxin-1 Desmonostoc muscorum
P81373 2.57e-05 42 36 2 61 1 None Ferredoxin-B Alocasia macrorrhizos
P81372 2.63e-05 42 31 3 89 1 None Ferredoxin-A Alocasia macrorrhizos
O04166 3.52e-05 42 28 2 87 2 PETF Ferredoxin, chloroplastic Physcomitrium patens
P83522 4.26e-05 41 34 2 61 1 None Ferredoxin Hordeum vulgare
P00223 4.3e-05 41 31 3 89 1 None Ferredoxin Arctium lappa
P17007 4.66e-05 41 29 3 93 1 petF Ferredoxin-1 Cyanophora paradoxa
Q03304 6.16e-05 42 30 4 89 1 tmoF Toluene-4-monooxygenase system, ferredoxin--NAD(+) reductase component Pseudomonas mendocina
P75824 6.21e-05 42 37 2 62 1 hcr NADH oxidoreductase HCR Escherichia coli (strain K12)
P27788 6.28e-05 42 30 4 89 1 FDX3 Ferredoxin-3, chloroplastic Zea mays
P00241 6.31e-05 41 31 3 91 1 PETF Ferredoxin Cyanidium caldarium
O98450 7.14e-05 41 28 3 92 3 petF Ferredoxin Thalassiosira weissflogii
P14938 7.21e-05 41 32 3 67 1 None Ferredoxin, leaf L-A Raphanus sativus
P09735 7.79e-05 40 28 3 90 1 None Ferredoxin Marchantia polymorpha
P16972 8.12e-05 42 34 2 61 1 FD2 Ferredoxin-2, chloroplastic Arabidopsis thaliana
O04683 8.12e-05 42 30 3 92 2 None Ferredoxin-1, chloroplastic Mesembryanthemum crystallinum
O80429 8.74e-05 41 34 2 61 1 FDX2 Ferredoxin-2, chloroplastic Zea mays
P00251 9.7e-05 40 28 3 92 1 None Ferredoxin-2 Aphanothece sacrum
P56408 0.000109 40 30 3 88 1 None Ferredoxin Scenedesmus fuscus
P00228 0.000169 40 31 3 89 1 PETF Ferredoxin, chloroplastic Triticum aestivum
P00226 0.000173 40 34 2 66 1 None Ferredoxin Sambucus nigra
P0A3D1 0.000178 40 32 4 94 3 petF1 Ferredoxin-1 Thermostichus vulcanus
P0A3C9 0.000178 40 32 4 94 1 petF1 Ferredoxin-1 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P0A3D0 0.000178 40 32 4 94 3 petF1 Ferredoxin-1 Synechococcus elongatus
A0R525 0.000183 41 37 1 56 3 kshB 3-ketosteroid-9-alpha-monooxygenase, ferredoxin reductase component Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P07838 0.000187 40 28 4 91 1 None Ferredoxin Bryopsis maxima
P00227 0.000201 40 32 3 67 1 None Ferredoxin Brassica napus
P00255 0.000288 39 32 3 91 1 None Ferredoxin Thermostichus lividus
P00230 0.000295 39 30 3 90 1 None Ferredoxin-1 Phytolacca acinosa
Q7WTJ2 0.000298 40 33 3 74 1 mphP Phenol hydroxylase P5 protein Acinetobacter pittii (strain PHEA-2)
P00233 0.000333 39 36 2 61 1 None Ferredoxin Gleichenia japonica
P14936 0.000355 39 30 4 89 1 None Ferredoxin, root R-B1 Raphanus sativus
P00222 0.00038 39 36 2 61 1 None Ferredoxin Colocasia esculenta
P00231 0.000387 39 32 3 67 1 None Ferredoxin-2 Phytolacca americana
P27787 0.000388 40 34 2 61 1 FDX1 Ferredoxin-1, chloroplastic Zea mays
P00238 0.000482 38 30 3 89 1 None Ferredoxin Scenedesmus quadricauda
P00232 0.000592 38 35 2 54 1 None Ferredoxin-2 Phytolacca acinosa
E9RFT0 0.000631 40 31 1 74 1 mimB Propane 2-monooxygenase, reductase component Mycolicibacterium goodii
Q0J8M2 0.000637 39 32 2 61 1 ADI1 Ferredoxin-1, chloroplastic Oryza sativa subsp. japonica
A2YQD9 0.000637 39 32 2 61 1 ADI1 Ferredoxin-1, chloroplastic Oryza sativa subsp. indica
P27789 0.000641 39 32 2 61 2 FDX5 Ferredoxin-5, chloroplastic Zea mays
P14937 0.000665 38 30 4 86 1 None Ferredoxin, root R-B2 Raphanus sativus
Q66DP5 0.000691 40 27 3 83 1 ascD CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase reductase Yersinia pseudotuberculosis serotype I (strain IP32953)
P68641 0.000691 40 27 3 83 3 ascD CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase reductase Yersinia pestis
P9WJ93 0.000755 39 41 1 48 1 hmp 3-ketosteroid-9-alpha-monooxygenase, ferredoxin reductase component Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJ92 0.000755 39 41 1 48 3 hmp 3-ketosteroid-9-alpha-monooxygenase, ferredoxin reductase component Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P27320 0.000759 38 30 3 71 1 petF Ferredoxin-1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P00250 0.000759 38 30 3 92 1 None Ferredoxin-1 Aphanothece sacrum
P84874 0.000784 38 38 2 54 1 None Ferredoxin-2 Hyoscyamus niger
P85121 0.000795 38 34 2 66 1 None Ferredoxin Panax ginseng
A0QTU9 0.00083 39 31 1 74 1 mimB Propane 2-monooxygenase, reductase component Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P00243 0.000835 38 32 3 67 1 None Ferredoxin Synechocystis sp. (strain PCC 6714)
Q8IED5 0.000846 39 34 3 88 1 FD Ferredoxin, apicoplast Plasmodium falciparum (isolate 3D7)
P00225 0.001 38 34 2 61 1 None Ferredoxin Leucaena leucocephala
P21394 0.001 39 28 3 92 1 xylA Xylene/toluene monooxygenase electron transfer component XylA Pseudomonas putida

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_02325
Feature type CDS
Gene yfaE
Product class I ribonucleotide reductase maintenance protein YfaE
Location 432884 - 433150 (strand: 1)
Length 267 (nucleotides) / 88 (amino acids)

Contig

Accession ZDB_519
Length 680340 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_437
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00111 2Fe-2S iron-sulfur cluster binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0633 Energy production and conversion (C) C Ferredoxin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11107 ferredoxin - -

Protein Sequence

MPRYKITLHGNMQGIQLHYVSEEHNNLLNTLEQSVPVEYQCREGYCGACRVRLKRGKVGYRQRPVAFINDGEILPCSCYPLSDIDIEL

Flanking regions ( +/- flanking 50bp)

CAGATTGACTCTGAAGTCAACACTGACGAACTGAGTAACTTCGAACTCTGATGCCCCGCTATAAAATCACCCTGCATGGCAACATGCAGGGTATTCAGCTGCATTATGTCAGTGAAGAACACAACAACCTGCTCAATACACTCGAACAATCCGTCCCGGTGGAATACCAGTGCCGTGAAGGCTATTGCGGTGCCTGCCGTGTCCGCCTGAAACGCGGTAAAGTCGGTTACCGGCAGAGGCCGGTTGCATTTATCAATGACGGTGAAATTCTTCCCTGCAGTTGCTACCCGCTGAGTGATATCGACATCGAATTGTAAGCTGTTTAGTGACCGGATCTGCAATCCGGTTTTTTTATGCCATTGGTGTA