Homologs in group_512

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00410 FBDBKF_00410 86.4 Morganella morganii S1 yfaE class I ribonucleotide reductase maintenance protein YfaE
EHELCC_01135 EHELCC_01135 86.4 Morganella morganii S2 yfaE class I ribonucleotide reductase maintenance protein YfaE
NLDBIP_02325 NLDBIP_02325 86.4 Morganella morganii S4 yfaE class I ribonucleotide reductase maintenance protein YfaE
LHKJJB_03840 LHKJJB_03840 86.4 Morganella morganii S3 yfaE class I ribonucleotide reductase maintenance protein YfaE
HKOGLL_03205 HKOGLL_03205 86.4 Morganella morganii S5 yfaE class I ribonucleotide reductase maintenance protein YfaE
PMI_RS08520 PMI_RS08520 58.0 Proteus mirabilis HI4320 yfaE class I ribonucleotide reductase maintenance protein YfaE

Distribution of the homologs in the orthogroup group_512

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_512

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ABW3 7.63e-22 84 51 3 85 4 yfaE Uncharacterized ferredoxin-like protein YfaE Escherichia coli (strain K12)
P0ABW4 7.63e-22 84 51 3 85 4 yfaE Uncharacterized ferredoxin-like protein YfaE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45154 9.63e-20 78 54 1 64 4 HI_1309 Uncharacterized ferredoxin-like protein HI_1309 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P57274 7.05e-13 61 37 2 80 4 BU177 Uncharacterized ferredoxin-like protein BU177 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89AS6 3.87e-11 57 33 3 90 4 bbp_166 Uncharacterized ferredoxin-like protein bbp_166 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9C7Y4 7.75e-09 52 32 3 94 2 FDC2 Ferredoxin C 2, chloroplastic Arabidopsis thaliana
P0A3D3 8.63e-08 48 27 3 93 1 petF1 Ferredoxin-1 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P0A3D2 8.63e-08 48 27 3 93 3 petF Ferredoxin-1 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q51577 1.42e-07 48 30 3 89 1 petF1 Ferredoxin-1 Leptolyngbya boryana
P00247 2.59e-07 47 29 3 93 1 None Ferredoxin Chlorogloeopsis fritschii
P75863 1.07e-06 47 37 3 75 1 ycbX Uncharacterized protein YcbX Escherichia coli (strain K12)
Q7WTJ2 1.74e-06 47 39 5 73 1 mphP Phenol hydroxylase P5 protein Acinetobacter pittii (strain PHEA-2)
P00254 3.07e-06 44 29 3 93 1 petF1 Ferredoxin-1 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
P15788 4.87e-06 44 28 3 89 1 PCC7418_2938 Ferredoxin Halothece sp. (strain PCC 7418)
P0A3C8 5.08e-06 43 30 3 90 1 petF Ferredoxin-1 Nostoc sp. (strain ATCC 29151 / PCC 7119)
P0A3C7 5.08e-06 43 30 3 90 1 petF Ferredoxin-1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P00221 8.44e-06 44 26 3 92 1 PETF Ferredoxin-1, chloroplastic Spinacia oleracea
Q66DP5 9.07e-06 45 32 2 74 1 ascD CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase reductase Yersinia pseudotuberculosis serotype I (strain IP32953)
P68641 9.07e-06 45 32 2 74 3 ascD CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase reductase Yersinia pestis
P51320 1.28e-05 43 28 3 89 3 petF Ferredoxin Porphyra purpurea
P00245 1.28e-05 43 25 3 89 1 None Ferredoxin Limnospira maxima
P00248 1.53e-05 42 27 3 93 1 petF Ferredoxin Mastigocladus laminosus
P00253 1.6e-05 42 28 3 90 1 None Ferredoxin Desmonostoc muscorum
P75824 2.22e-05 44 38 2 65 1 hcr NADH oxidoreductase HCR Escherichia coli (strain K12)
P04669 2.8e-05 43 25 2 92 2 PETF Ferredoxin, chloroplastic Silene latifolia subsp. alba
Q9TLW0 3.53e-05 42 27 2 87 3 petF Ferredoxin Cyanidium caldarium
P00246 4.06e-05 41 25 3 89 1 None Ferredoxin Arthrospira platensis
P0A3D1 6.04e-05 41 31 4 91 3 petF1 Ferredoxin-1 Thermostichus vulcanus
P0A3C9 6.04e-05 41 31 4 91 1 petF1 Ferredoxin-1 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P0A3D0 6.04e-05 41 31 4 91 3 petF1 Ferredoxin-1 Synechococcus elongatus
O78510 6.12e-05 41 27 3 87 3 petF Ferredoxin Guillardia theta
P00224 8e-05 40 25 3 90 1 None Ferredoxin-2 Spinacia oleracea
A0R525 8.03e-05 42 39 1 56 3 kshB 3-ketosteroid-9-alpha-monooxygenase, ferredoxin reductase component Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P00242 9.56e-05 40 28 3 88 1 PETF Ferredoxin Porphyra umbilicalis
Q1XDG7 9.95e-05 40 28 3 89 3 petF Ferredoxin Neopyropia yezoensis
O04166 0.000105 41 28 2 87 2 PETF Ferredoxin, chloroplastic Physcomitrium patens
P19734 0.000108 42 30 5 91 1 dmpP Phenol 2-monooxygenase, reductase component DmpP Pseudomonas sp. (strain CF600)
P00255 0.000149 40 31 3 88 1 None Ferredoxin Thermostichus lividus
P15789 0.000167 40 29 2 84 1 PETF Ferredoxin Cyanidium caldarium
P07838 0.000284 39 27 2 87 1 None Ferredoxin Bryopsis maxima
O80429 0.000356 40 28 2 73 1 FDX2 Ferredoxin-2, chloroplastic Zea mays
P81372 0.000368 39 27 2 80 1 None Ferredoxin-A Alocasia macrorrhizos
P9WJ93 0.000384 40 45 1 48 1 hmp 3-ketosteroid-9-alpha-monooxygenase, ferredoxin reductase component Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJ92 0.000384 40 45 1 48 3 hmp 3-ketosteroid-9-alpha-monooxygenase, ferredoxin reductase component Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P81373 0.000395 39 28 2 71 1 None Ferredoxin-B Alocasia macrorrhizos
P83522 0.000401 39 25 3 90 1 None Ferredoxin Hordeum vulgare
P21394 0.000415 40 29 3 92 1 xylA Xylene/toluene monooxygenase electron transfer component XylA Pseudomonas putida
P49522 0.000609 38 26 3 89 3 petF Ferredoxin Trieres chinensis
P00250 0.000668 38 28 3 92 1 None Ferredoxin-1 Aphanothece sacrum
P00252 0.000699 38 26 4 90 1 None Ferredoxin-1 Desmonostoc muscorum
P14936 0.000877 38 28 2 70 1 None Ferredoxin, root R-B1 Raphanus sativus
P00241 0.001 38 29 3 87 1 PETF Ferredoxin Cyanidium caldarium
Q03304 0.001 39 27 3 79 1 tmoF Toluene-4-monooxygenase system, ferredoxin--NAD(+) reductase component Pseudomonas mendocina
W7MSJ7 0.001 39 37 1 53 2 FVEG_12641 Reductase FVEG_12641 Gibberella moniliformis (strain M3125 / FGSC 7600)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06390
Feature type CDS
Gene yfaE
Product class I ribonucleotide reductase maintenance protein YfaE
Location 1334079 - 1334345 (strand: 1)
Length 267 (nucleotides) / 88 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_512
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00111 2Fe-2S iron-sulfur cluster binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0633 Energy production and conversion (C) C Ferredoxin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11107 ferredoxin - -

Protein Sequence

MPSHKITLHGNMQGIQLRYVSEEHHTLLNTLEQSVPVEFQCREGYCGACRVRLKRGKVGYRTRPVAFIRDGEILPCCCYPMSDIELEL

Flanking regions ( +/- flanking 50bp)

CAGATAGACTCTGAAGTCAATACTGATGAACTGAGTAGTTTCGAGCTCTGATGCCAAGCCATAAAATTACCCTGCATGGCAACATGCAGGGGATACAACTGCGTTATGTCAGTGAAGAACATCACACCCTGCTCAATACTCTCGAACAATCCGTTCCTGTCGAATTTCAGTGCCGTGAAGGGTATTGCGGTGCCTGTCGTGTCCGGCTGAAACGCGGAAAAGTCGGTTACCGCACCCGCCCGGTCGCCTTTATCCGCGACGGCGAAATTCTCCCCTGCTGCTGTTACCCGATGAGTGATATTGAACTCGAGCTCTGAACCAGTTCATGACCATTTTTGTGACCGGATCTGCAATCCGGTTTTTTTAC