Homologs in group_414

Help

7 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17985 FBDBKF_17985 100.0 Morganella morganii S1 - Fimbrial protein
EHELCC_06350 EHELCC_06350 100.0 Morganella morganii S2 - Fimbrial protein
NLDBIP_06670 NLDBIP_06670 100.0 Morganella morganii S4 - Fimbrial protein
HKOGLL_04720 HKOGLL_04720 100.0 Morganella morganii S5 - Fimbrial protein
PMI_RS02650 PMI_RS02650 56.0 Proteus mirabilis HI4320 ucaA uroepithelial cell adherence major pilin UcaA
PMI_RS05160 PMI_RS05160 33.3 Proteus mirabilis HI4320 - fimbrial protein
PMI_RS12930 PMI_RS12930 100.0 Proteus mirabilis HI4320 - fimbrial protein

Distribution of the homologs in the orthogroup group_414

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_414

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P11312 6.02e-34 119 59 2 111 3 F17a-A F17 fimbrial protein Escherichia coli
P45989 1.76e-11 62 37 7 147 3 hifA Major fimbrial subunit Haemophilus influenzae
P14212 1.81e-11 62 37 7 147 1 hifA Major fimbrial subunit Haemophilus influenzae
P45988 1.16e-10 60 35 5 145 3 hifA Major fimbrial subunit Haemophilus influenzae
B2FNJ0 1.43e-10 58 44 3 111 1 smf-1 Major fimbrial subunit SMF-1 Stenotrophomonas maltophilia (strain K279a)
Q03846 1.71e-07 51 35 8 150 3 hifA Major fimbrial subunit Haemophilus influenzae
P45990 1.39e-06 48 33 6 141 3 hifA Major fimbrial subunit Haemophilus influenzae
Q8X582 4.7e-05 44 39 1 73 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7
P75855 9.87e-05 43 34 2 116 1 elfA Fimbrial subunit ElfA Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_19270
Feature type CDS
Gene -
Product Fimbrial protein
Location 58 - 468 (strand: 1)
Length 411 (nucleotides) / 136 (amino acids)

Contig

Accession ZDB_390
Length 13558 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_414
Orthogroup size 8
N. genomes 6

Actions

Genomic region

Domains

PF16970 Type-1 fimbrial protein, A

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Protein Sequence

MKFKNNIALSTVLSVAIFNSAMAYDGTISLTGCTTGQNGSSNVKAFFEPGANTDFNTNKLKNASSDGAQNVQIQLLNNDGTTAIQLGKDFVGQDVHSEAINSDDEATLRYMAQYYATGKAIVGDVISSVNYTIAYE

Flanking regions ( +/- flanking 50bp)

AATACCCTCAATGAAGTTTATAGATTGATTTTTATGTTAGTAACCAAATAATGAAATTTAAAAATAATATTGCTTTAAGTACGGTACTGTCTGTTGCTATTTTTAACTCAGCAATGGCATATGACGGTACAATTAGTCTTACTGGATGCACTACTGGACAAAATGGATCTAGTAATGTGAAAGCTTTTTTTGAACCCGGAGCTAATACTGACTTTAATACGAACAAACTAAAAAATGCAAGCTCTGACGGAGCACAAAATGTTCAAATTCAGTTATTAAATAACGATGGTACTACTGCTATTCAATTAGGGAAAGACTTTGTCGGACAGGATGTCCATTCAGAAGCTATTAATAGTGACGATGAAGCGACACTACGCTATATGGCCCAATATTATGCTACAGGAAAAGCAATTGTAGGGGATGTCATTTCTAGTGTTAATTACACTATTGCCTATGAGTAATAAATAATAATCGTGCGTTTTTATTATCATTATTTACAAGGCAGCTCATC