Homologs in group_2359

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17985 FBDBKF_17985 56.0 Morganella morganii S1 - Fimbrial protein
EHELCC_06350 EHELCC_06350 56.0 Morganella morganii S2 - Fimbrial protein
NLDBIP_06670 NLDBIP_06670 56.0 Morganella morganii S4 - Fimbrial protein
LHKJJB_19270 LHKJJB_19270 56.0 Morganella morganii S3 - Fimbrial protein
HKOGLL_04720 HKOGLL_04720 56.0 Morganella morganii S5 - Fimbrial protein
PMI_RS12930 PMI_RS12930 56.0 Proteus mirabilis HI4320 - fimbrial protein

Distribution of the homologs in the orthogroup group_2359

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2359

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P11312 2.32e-57 181 56 2 180 3 F17a-A F17 fimbrial protein Escherichia coli
B2FNJ0 5.97e-24 95 45 4 162 1 smf-1 Major fimbrial subunit SMF-1 Stenotrophomonas maltophilia (strain K279a)
P45990 2.79e-22 92 34 7 212 3 hifA Major fimbrial subunit Haemophilus influenzae
P45992 5.23e-22 91 37 7 177 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P45988 1.52e-20 87 34 5 204 3 hifA Major fimbrial subunit Haemophilus influenzae
P14212 2.54e-20 87 33 8 215 1 hifA Major fimbrial subunit Haemophilus influenzae
P45989 1.09e-19 85 33 8 215 3 hifA Major fimbrial subunit Haemophilus influenzae
Q03846 2.78e-19 84 33 9 220 3 hifA Major fimbrial subunit Haemophilus influenzae
P45993 1.9e-15 73 35 6 142 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
P09808 3.29e-14 70 33 5 161 3 fimX Fimbrial protein FimX Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P17835 4.33e-13 67 33 6 162 3 fim3 Serotype 3 fimbrial subunit Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P12730 4.48e-13 67 32 9 191 1 sfaA S-fimbrial protein subunit SfaA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P05788 1.93e-11 63 38 4 126 3 fim2 Serotype 2 fimbrial subunit Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8X582 2.52e-11 62 31 7 188 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7
P43660 2.17e-10 60 32 6 192 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P75855 3.84e-10 59 30 7 188 1 elfA Fimbrial subunit ElfA Escherichia coli (strain K12)
P35076 1.59e-09 57 31 6 147 3 fimA Protein FimA Bordetella pertussis
P42913 3.86e-09 57 26 7 189 2 yraH Uncharacterized fimbrial-like protein YraH Escherichia coli (strain K12)
P08189 5.4e-09 56 29 7 188 1 fimF Protein FimF Escherichia coli (strain K12)
Q03011 3.28e-08 53 28 7 185 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
P37920 7.15e-08 53 28 7 191 3 fimA Type-1 fimbrial protein, A chain Salmonella typhi
P38052 8.99e-08 52 29 8 185 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
P37921 9.99e-08 52 29 9 194 1 fimA Type-1 fimbrial protein, A chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P12903 1.21e-07 52 34 6 180 1 fim Fimbrial subunit type 1 Klebsiella pneumoniae
P13430 5.2e-07 50 28 5 180 1 sfaS S-fimbrial adhesin protein SfaS Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P0ABW5 5.38e-07 50 33 6 161 2 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli (strain K12)
P0ABW6 5.38e-07 50 33 6 161 3 sfmA Uncharacterized fimbrial-like protein SfmA Escherichia coli O157:H7
Q8X5K5 1.15e-06 49 28 7 190 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P39264 1.2e-06 49 23 6 188 1 fimI Fimbrin-like protein FimI Escherichia coli (strain K12)
P37922 2.08e-06 48 23 7 187 3 fimI Fimbrin-like protein FimI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P62605 3.31e-06 48 27 6 196 3 pilC Type-1 fimbrial protein, C chain Escherichia coli
P62606 3.31e-06 48 27 6 196 3 pilC Type-1 fimbrial protein, C chain Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P04128 5.5e-06 48 30 4 158 1 fimA Type-1 fimbrial protein, A chain Escherichia coli (strain K12)
P55223 7.21e-06 47 29 6 161 3 None Fimbrial subunit type 1 Salmonella typhimurium
Q00879 8.11e-06 48 30 6 150 3 fhaE Protein FhaE Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P62532 9.46e-06 47 27 8 173 1 papK Fimbrial adapter PapK Escherichia coli
P62533 9.46e-06 47 27 8 173 3 papK Fimbrial adapter PapK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q47223 2.35e-05 46 28 5 191 1 fimA Type-1 fimbrial protein, A chain Escherichia coli
P12266 4.12e-05 45 31 5 161 1 None Fimbrial subunit type 1 Klebsiella pneumoniae
P77789 4.24e-05 45 24 5 177 3 ydeS Uncharacterized fimbrial-like protein YdeS Escherichia coli (strain K12)
P21648 0.000112 45 27 7 155 1 mrkD Fimbria adhesin protein Klebsiella pneumoniae
P22595 0.000169 43 28 9 190 3 fimA Type-1 fimbrial protein subunit Serratia marcescens
P75860 0.000299 43 24 7 183 2 ycbV Uncharacterized fimbrial-like protein YcbV Escherichia coli (strain K12)
P13421 0.000442 42 30 9 193 1 smfA Fimbria A protein Serratia marcescens
P39834 0.000604 42 29 9 168 3 ygiL Uncharacterized fimbrial-like protein YgiL Escherichia coli (strain K12)
P42184 0.000793 41 42 2 56 1 prsA PRS fimbrial major pilin protein (Fragment) Escherichia coli

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS02650
Feature type CDS
Gene ucaA
Product uroepithelial cell adherence major pilin UcaA
Location 579491 - 580036 (strand: -1)
Length 546 (nucleotides) / 181 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2359
Orthogroup size 7
N. genomes 6

Actions

Genomic region

Domains

PF16970 Type-1 fimbrial protein, A

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07345 major type 1 subunit fimbrin (pilin) Shigellosis
Pertussis
-

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG042619 uroepithelial cell adherence major pilin UcaA VF1235 Adherence

Protein Sequence

MKRKVIALATILSAAFAGSSMAYDGTITFTGKVVDQTCSVDTQSKNLAVILPTVSVATLNNVATTAGLTPFTIKLTGCSTDKDGAKNVKVYFEPSADTDLTTHNLKNTATGTKANNVQVQLLNSDAATTIQLGTDVNSQNVQEVQIDNADVNLPYFAQYYATGSSTAGDVKATVHYTIAYE

Flanking regions ( +/- flanking 50bp)

GAAAAACAAAAAATAACTTAACTTTAATTTAAAATAGGAATCATAAATATATGAAAAGAAAAGTTATAGCACTAGCTACTATTCTTTCTGCTGCATTTGCTGGCTCATCTATGGCGTATGACGGAACAATTACATTTACAGGTAAAGTTGTTGATCAAACATGTTCTGTTGATACCCAATCAAAAAATTTAGCTGTTATTTTGCCGACTGTTTCAGTCGCAACATTAAATAATGTAGCAACAACAGCAGGCTTAACTCCATTTACAATTAAGTTAACTGGTTGTTCCACAGATAAAGATGGTGCTAAAAACGTTAAAGTATATTTTGAACCATCCGCTGATACTGATTTAACTACACATAATTTAAAAAATACAGCAACAGGAACTAAAGCGAATAATGTTCAAGTTCAATTACTTAACTCAGATGCAGCAACAACAATTCAGTTAGGTACTGATGTTAACTCACAAAATGTTCAGGAAGTACAAATCGACAATGCTGATGTAAACCTTCCATATTTTGCTCAATATTATGCAACCGGATCATCTACCGCTGGGGATGTAAAAGCAACCGTTCATTACACCATTGCCTATGAGTAAGGTTTATTGGATTGCTTTTATTTTACGGGGCAGAAAAAACTGCCCCATTT