Homologs in group_296

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07445 FBDBKF_07445 100.0 Morganella morganii S1 cobA Uroporphyrinogen-III methylase (siroheme synthase)
EHELCC_17115 EHELCC_17115 100.0 Morganella morganii S2 cobA Uroporphyrinogen-III methylase (siroheme synthase)
NLDBIP_18495 NLDBIP_18495 100.0 Morganella morganii S4 cobA Uroporphyrinogen-III methylase (siroheme synthase)
HKOGLL_08680 HKOGLL_08680 100.0 Morganella morganii S5 cobA Uroporphyrinogen-III methylase (siroheme synthase)
F4V73_RS13675 F4V73_RS13675 91.6 Morganella psychrotolerans cobA uroporphyrinogen-III C-methyltransferase
PMI_RS07150 PMI_RS07150 46.4 Proteus mirabilis HI4320 cysG siroheme synthase CysG
PMI_RS11070 PMI_RS11070 45.2 Proteus mirabilis HI4320 cysG siroheme synthase CysG

Distribution of the homologs in the orthogroup group_296

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_296

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O34744 5.09e-78 239 48 1 247 2 sumT Uroporphyrinogen-III C-methyltransferase Bacillus subtilis (strain 168)
B1JBD9 1.77e-76 242 49 1 248 3 cysG Siroheme synthase Pseudomonas putida (strain W619)
Q2Y6L7 4.64e-76 241 49 0 242 3 cysG Siroheme synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q1H3L5 9.03e-76 240 48 0 243 3 cysG Siroheme synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q3SG32 2.69e-75 239 46 1 260 3 cysG Siroheme synthase Thiobacillus denitrificans (strain ATCC 25259)
Q1IBC9 2.78e-75 239 49 0 241 3 cysG Siroheme synthase Pseudomonas entomophila (strain L48)
C5BGP8 3.2e-75 239 51 2 239 3 cysG Siroheme synthase Edwardsiella ictaluri (strain 93-146)
Q820Q4 5.33e-75 238 48 0 241 3 cysG Siroheme synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A4XUX3 5.5e-75 238 49 0 241 3 cysG Siroheme synthase Pseudomonas mendocina (strain ymp)
P29928 1.31e-74 230 49 1 236 1 cobA Uroporphyrinogen-III C-methyltransferase Priestia megaterium
Q88FT3 1.5e-74 237 48 0 241 3 cysG Siroheme synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q48H75 1.66e-74 237 48 0 241 3 cysG Siroheme synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZRL6 2.04e-74 236 48 0 241 3 cysG Siroheme synthase Pseudomonas syringae pv. syringae (strain B728a)
Q87ZT0 2.53e-74 236 48 0 241 3 cysG Siroheme synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4K9V8 1.03e-73 235 48 0 241 3 cysG Siroheme synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A5W1H7 1.21e-73 234 48 0 241 3 cysG Siroheme synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A6V4H6 1.6e-73 234 46 0 244 3 cysG Siroheme synthase Pseudomonas aeruginosa (strain PA7)
Q02NA3 3.77e-73 233 46 0 244 3 cysG Siroheme synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9I0M7 3.9e-73 233 46 0 244 3 cysG Siroheme synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7UW11 4.93e-73 233 46 0 244 3 cysG Siroheme synthase Pseudomonas aeruginosa (strain LESB58)
A4VLU6 8.53e-73 233 49 0 241 3 cysG Siroheme synthase Stutzerimonas stutzeri (strain A1501)
C1DKY7 1.11e-72 232 47 0 241 3 cysG Siroheme synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
P42437 1.28e-72 233 47 1 241 2 nasF Uroporphyrinogen-III C-methyltransferase Bacillus subtilis (strain 168)
Q0VQ05 1.5e-72 232 45 0 239 3 cysG Siroheme synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q6F8G6 2.08e-72 231 46 0 242 3 cysG Siroheme synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q3KA85 2.54e-72 231 47 0 244 3 cysG Siroheme synthase Pseudomonas fluorescens (strain Pf0-1)
Q3JCS0 6.93e-72 230 45 1 257 3 cysG Siroheme synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
C3JY53 7.13e-72 230 46 0 241 3 cysG Siroheme synthase Pseudomonas fluorescens (strain SBW25)
B8GUD3 1.12e-71 230 45 0 241 3 cysG Siroheme synthase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q59294 1.84e-71 230 46 1 245 3 hemD Porphyrin biosynthesis protein HemD Ruminiclostridium josui
Q46BL0 6.21e-71 221 48 1 250 1 Mbar_A1791 S-adenosyl-L-methionine-dependent uroporphyrinogen III methyltransferase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q6D1A4 1.32e-70 227 47 3 255 3 cysG1 Siroheme synthase 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A6VPZ6 1.36e-70 227 49 2 253 3 cysG Siroheme synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q0AHC1 2.18e-70 226 46 0 241 3 cysG Siroheme synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A1JJS8 2.42e-70 226 47 1 247 3 cysG1 Siroheme synthase 1 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B5F8J0 2.77e-69 223 47 2 248 3 cysG Siroheme synthase Salmonella agona (strain SL483)
Q65T49 3.62e-69 223 49 1 241 3 cysG Siroheme synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A8AQS4 3.75e-69 223 48 2 242 3 cysG Siroheme synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q7NZV7 5.57e-69 223 48 0 239 3 cysG Siroheme synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A7MKK9 6.69e-69 222 46 2 247 3 cysG2 Siroheme synthase 2 Cronobacter sakazakii (strain ATCC BAA-894)
Q8FCW8 7.37e-69 222 47 2 242 3 cysG Siroheme synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7UK79 7.37e-69 222 47 2 242 3 cysG Siroheme synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B5R7N6 7.53e-69 222 48 2 242 3 cysG Siroheme synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q0TC92 7.78e-69 222 47 2 242 3 cysG Siroheme synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A4WFH1 8.12e-69 222 48 2 242 3 cysG Siroheme synthase Enterobacter sp. (strain 638)
C0Q0F3 8.94e-69 222 48 2 242 3 cysG Siroheme synthase Salmonella paratyphi C (strain RKS4594)
A9MT45 8.94e-69 222 48 2 242 3 cysG Siroheme synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5R2C7 8.94e-69 222 48 2 242 3 cysG Siroheme synthase Salmonella enteritidis PT4 (strain P125109)
Q57IZ5 8.94e-69 222 48 2 242 3 cysG Siroheme synthase Salmonella choleraesuis (strain SC-B67)
B1LHG9 9.04e-69 222 47 2 242 3 cysG Siroheme synthase Escherichia coli (strain SMS-3-5 / SECEC)
B6I2S7 9.04e-69 222 47 2 242 3 cysG Siroheme synthase Escherichia coli (strain SE11)
P0AEA8 9.04e-69 222 47 2 242 1 cysG Siroheme synthase Escherichia coli (strain K12)
B1IP96 9.04e-69 222 47 2 242 3 cysG Siroheme synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A5H5 9.04e-69 222 47 2 242 3 cysG Siroheme synthase Escherichia coli O9:H4 (strain HS)
B1X716 9.04e-69 222 47 2 242 3 cysG Siroheme synthase Escherichia coli (strain K12 / DH10B)
C4ZUM4 9.04e-69 222 47 2 242 3 cysG Siroheme synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1S1 9.04e-69 222 47 2 242 3 cysG Siroheme synthase Escherichia coli O8 (strain IAI1)
P0AEA9 9.04e-69 222 47 2 242 3 cysG Siroheme synthase Escherichia coli O157:H7
B7L4P2 9.04e-69 222 47 2 242 3 cysG Siroheme synthase Escherichia coli (strain 55989 / EAEC)
A7ZSP4 9.04e-69 222 47 2 242 3 cysG Siroheme synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
B4TKQ4 9.14e-69 222 48 2 242 3 cysG Siroheme synthase Salmonella heidelberg (strain SL476)
B5FJQ1 9.24e-69 222 48 2 242 3 cysG Siroheme synthase Salmonella dublin (strain CT_02021853)
Q606C9 9.33e-69 222 46 1 242 3 cysG Siroheme synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q3YWQ3 9.33e-69 222 47 2 242 3 cysG Siroheme synthase Shigella sonnei (strain Ss046)
Q83JB3 9.33e-69 222 47 2 242 3 cysG Siroheme synthase Shigella flexneri
Q0SZU8 9.33e-69 222 47 2 242 3 cysG Siroheme synthase Shigella flexneri serotype 5b (strain 8401)
B4SVI1 9.54e-69 222 48 2 242 3 cysG Siroheme synthase Salmonella newport (strain SL254)
Q31VS0 9.74e-69 222 47 2 242 3 cysG Siroheme synthase Shigella boydii serotype 4 (strain Sb227)
B2U3H4 9.74e-69 222 47 2 242 3 cysG Siroheme synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7NMD7 9.74e-69 222 47 2 242 3 cysG Siroheme synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A9MME5 1.05e-68 222 47 2 245 3 cysG Siroheme synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B7NDX8 1.1e-68 221 47 2 242 3 cysG Siroheme synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B5YTS6 1.1e-68 221 47 2 242 3 cysG Siroheme synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q1R5R3 1.13e-68 221 47 2 242 3 cysG Siroheme synthase Escherichia coli (strain UTI89 / UPEC)
A1AGQ2 1.13e-68 221 47 2 242 3 cysG Siroheme synthase Escherichia coli O1:K1 / APEC
B7MCY5 1.13e-68 221 47 2 242 3 cysG Siroheme synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7N1F1 1.14e-68 221 47 2 242 3 cysG Siroheme synthase Escherichia coli O81 (strain ED1a)
B5BH22 1.46e-68 221 48 2 242 3 cysG Siroheme synthase Salmonella paratyphi A (strain AKU_12601)
Q5PLV8 1.46e-68 221 48 2 242 3 cysG Siroheme synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P25924 1.51e-68 221 48 2 242 1 cysG Siroheme synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B0BTC2 1.53e-68 222 47 2 254 3 cysG Siroheme synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A7MJ67 2.11e-68 221 47 1 242 3 cysG1 Siroheme synthase 1 Cronobacter sakazakii (strain ATCC BAA-894)
B3GZA0 2.22e-68 221 47 2 254 3 cysG Siroheme synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A8GKQ1 2.35e-68 221 48 3 248 3 cysG2 Siroheme synthase 2 Serratia proteamaculans (strain 568)
B4TY38 2.35e-68 221 48 2 242 3 cysG Siroheme synthase Salmonella schwarzengrund (strain CVM19633)
A1AVU5 2.57e-68 221 42 0 254 3 cysG Siroheme synthase Ruthia magnifica subsp. Calyptogena magnifica
A1JSB7 2.89e-68 221 46 2 246 3 cysG2 Siroheme synthase 2 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P95370 3.07e-68 221 49 1 241 3 cysG Siroheme synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A0KQJ4 4.82e-68 220 48 1 243 3 cysG3 Siroheme synthase 3 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q7N8L2 5.76e-68 220 46 1 246 3 cysG Siroheme synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q0A812 7.34e-68 220 44 0 254 3 cysG Siroheme synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A9LZ77 7.4e-68 220 49 1 241 3 cysG Siroheme synthase Neisseria meningitidis serogroup C (strain 053442)
P57001 9.4e-68 220 49 1 241 3 cysG Siroheme synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q58375 1.05e-67 212 49 3 226 3 cobA Uroporphyrinogen-III C-methyltransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A1KU10 1.39e-67 219 49 1 241 3 cysG Siroheme synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q8Z201 1.39e-67 219 47 2 242 3 cysG Siroheme synthase Salmonella typhi
Q664M6 1.52e-67 219 47 2 247 3 cysG2 Siroheme synthase 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FNS9 1.52e-67 219 47 2 247 3 cysG2 Siroheme synthase 2 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q74Y23 1.54e-67 219 47 2 247 3 cysG Siroheme synthase Yersinia pestis
Q1C2P9 1.54e-67 219 47 2 247 3 cysG Siroheme synthase Yersinia pestis bv. Antiqua (strain Antiqua)
Q1CCP6 1.54e-67 219 47 2 247 3 cysG2 Siroheme synthase 2 Yersinia pestis bv. Antiqua (strain Nepal516)
A4TGU8 1.71e-67 219 47 2 247 3 cysG1 Siroheme synthase 1 Yersinia pestis (strain Pestoides F)
B7LS75 2.16e-67 218 46 2 242 3 cysG Siroheme synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q32AZ8 3.54e-67 218 46 2 242 3 cysG Siroheme synthase Shigella dysenteriae serotype 1 (strain Sd197)
A6TF07 5.98e-67 217 47 2 242 3 cysG2 Siroheme synthase 2 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A0KP37 6.01e-67 218 52 4 243 3 cysG2 Siroheme synthase 2 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q21K21 7.76e-67 217 43 0 239 3 cysG Siroheme synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A4SHL4 1.24e-66 216 47 1 243 3 cysG1 Siroheme synthase 1 Aeromonas salmonicida (strain A449)
A5CXE4 2.19e-65 213 43 0 241 3 cysG Siroheme synthase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q1QAX7 2.73e-65 214 44 0 243 3 cysG Siroheme synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A9H259 3.08e-65 213 45 2 242 3 cysG Siroheme synthase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q3ILQ9 3.8e-65 213 41 0 240 3 cysG Siroheme synthase Pseudoalteromonas translucida (strain TAC 125)
Q5FP95 3.84e-65 213 44 2 243 3 cysG Siroheme synthase Gluconobacter oxydans (strain 621H)
A0KLD7 5.34e-65 212 48 1 237 3 cysG1 Siroheme synthase 1 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q1LTP4 6.45e-65 212 45 2 236 3 cysG Siroheme synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q2SJB7 7e-65 212 45 0 241 3 cysG Siroheme synthase Hahella chejuensis (strain KCTC 2396)
Q15YU1 9.19e-65 211 47 0 242 3 cysG Siroheme synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q66EC9 4.52e-64 210 47 1 245 3 cysG1 Siroheme synthase 1 Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FLY4 5.19e-64 210 47 1 245 3 cysG1 Siroheme synthase 1 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TPZ1 1.85e-63 208 47 1 245 3 cysG2 Siroheme synthase 2 Yersinia pestis (strain Pestoides F)
Q1CLS2 1.85e-63 208 47 1 245 3 cysG1 Siroheme synthase 1 Yersinia pestis bv. Antiqua (strain Nepal516)
C4LAG5 3.13e-63 208 48 1 241 3 cysG Siroheme synthase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q4FSU1 6.69e-63 209 43 0 243 3 cysG Siroheme synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A1WWP8 7.22e-63 207 44 0 242 3 cysG1 Siroheme synthase 1 Halorhodospira halophila (strain DSM 244 / SL1)
A4SRH0 1.01e-62 207 50 4 243 3 cysG2 Siroheme synthase 2 Aeromonas salmonicida (strain A449)
Q493N1 1.03e-62 206 44 2 238 3 cysG Siroheme synthase Blochmanniella pennsylvanica (strain BPEN)
Q6CZS0 1.06e-62 206 42 2 247 3 cysG2 Siroheme synthase 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A5WEG6 2.15e-62 206 42 2 251 3 cysG Siroheme synthase Psychrobacter sp. (strain PRwf-1)
A1SRP9 2.42e-62 206 47 1 244 3 cysG Siroheme synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q31GG8 2.76e-62 206 40 0 242 3 cysG Siroheme synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q6LM67 4.82e-62 205 43 2 253 3 cysG Siroheme synthase Photobacterium profundum (strain SS9)
A6TD45 7.17e-61 202 48 1 241 3 cysG1 Siroheme synthase 1 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P21631 1.23e-60 196 45 3 248 1 cobA Uroporphyrinogen-III C-methyltransferase Sinorhizobium sp.
Q2NVN0 2.04e-60 201 47 1 236 3 cysG Siroheme synthase Sodalis glossinidius (strain morsitans)
Q9I2W4 3.18e-60 193 42 2 235 3 cobA Uroporphyrinogen-III C-methyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7VZ77 3.48e-60 200 43 1 243 3 cysG Siroheme synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7VQG9 3.58e-60 199 41 2 239 3 cysG Siroheme synthase Blochmanniella floridana
Q87AI5 3.68e-60 200 43 0 244 3 cysG Siroheme synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I985 3.68e-60 200 43 0 244 3 cysG Siroheme synthase Xylella fastidiosa (strain M23)
A1WYD5 6.81e-60 200 47 2 244 3 cysG2 Siroheme synthase 2 Halorhodospira halophila (strain DSM 244 / SL1)
Q7WB57 7.17e-60 199 43 1 243 3 cysG Siroheme synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WMM4 7.17e-60 199 43 1 243 3 cysG Siroheme synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B0U4X0 1.56e-59 198 42 1 256 3 cysG Siroheme synthase Xylella fastidiosa (strain M12)
A9HZV6 2.83e-59 197 43 1 254 3 cysG Siroheme synthase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q2KWB0 2.86e-59 197 44 1 242 3 cysG Siroheme synthase Bordetella avium (strain 197N)
Q9PF46 3.4e-59 197 42 1 256 3 cysG Siroheme synthase Xylella fastidiosa (strain 9a5c)
Q5NRM4 9.6e-59 196 40 1 249 3 cysG Siroheme synthase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
P57500 2.11e-58 195 39 2 249 3 cysG Siroheme synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q55749 8.98e-58 187 43 2 236 3 cobA Uroporphyrinogen-III C-methyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A8G9Y3 1.81e-57 193 45 1 247 3 cysG1 Siroheme synthase 1 Serratia proteamaculans (strain 568)
P42451 3.51e-57 186 40 4 242 3 cobA Uroporphyrinogen-III C-methyltransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P29564 5.37e-56 182 44 5 229 1 cobA Uroporphyrinogen-III C-methyltransferase Methanobacterium ivanovii
Q51701 1.45e-53 177 42 1 242 3 nirE Uroporphyrinogen-III C-methyltransferase Paracoccus denitrificans (strain Pd 1222)
Q42606 1.62e-53 180 42 1 237 1 UPM1 S-adenosyl-L-methionine-dependent uroporphyrinogen III methyltransferase, chloroplastic Arabidopsis thaliana
O19889 1.01e-49 167 34 1 240 3 cobA Uroporphyrinogen-III C-methyltransferase Cyanidium caldarium
P37725 6.82e-48 162 38 2 236 3 cobA Uroporphyrinogen-III C-methyltransferase Pseudomonas fluorescens
Q58973 1.13e-34 128 33 5 238 3 cbiF Cobalt-precorrin-4 C(11)-methyltransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O74468 1.07e-33 130 34 1 235 2 SPCC1739.06c Probable uroporphyrinogen-III C-methyltransferase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P36150 4.98e-32 126 35 1 234 1 MET1 Uroporphyrinogen-III C-methyltransferase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P0A2G9 9.81e-31 117 30 4 236 1 cbiF Cobalt-precorrin-4 C(11)-methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2H0 9.81e-31 117 30 4 236 3 cbiF Cobalt-precorrin-4 C(11)-methyltransferase Salmonella typhi
O87696 3.49e-24 100 30 5 240 1 cbiF Cobalt-precorrin-4 C(11)-methyltransferase Priestia megaterium
P9WGB1 1.33e-23 99 30 3 235 1 cobM Precorrin-4 C(11)-methyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGB0 1.33e-23 99 30 3 235 3 cobM Precorrin-4 C(11)-methyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q53138 1.62e-23 98 30 5 235 3 cobM Precorrin-4 C(11)-methyltransferase Rhodococcus erythropolis
Q9HZP9 3.03e-20 90 30 6 234 3 cobM Precorrin-4 C(11)-methyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P21922 7.75e-18 83 30 4 231 1 cobM Precorrin-4 C(11)-methyltransferase Sinorhizobium sp.
O68100 1.53e-13 71 30 5 232 1 cobM Precorrin-4 C(11)-methyltransferase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
O87689 5.65e-11 65 27 8 253 1 cbiH60 Cobalt-factor III methyltransferase Priestia megaterium
Q05590 4.68e-07 53 24 7 242 1 cbiH Probable cobalt-factor III C(17)-methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q58917 0.000128 45 24 10 216 3 cbiE Probable cobalt-precorrin-7 C(5)-methyltransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P21639 0.000296 44 26 6 179 1 cobI Precorrin-2 C(20)-methyltransferase Sinorhizobium sp.

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_09130
Feature type CDS
Gene cobA
Product Uroporphyrinogen-III methylase (siroheme synthase)
Location 163454 - 164239 (strand: -1)
Length 786 (nucleotides) / 261 (amino acids)

Contig

Accession ZDB_365
Length 192330 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_296
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00590 Tetrapyrrole (Corrin/Porphyrin) Methylases

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0007 Coenzyme transport and metabolism (H) H Uroporphyrinogen-III methylase (siroheme synthase)

Kegg Ortholog Annotation(s)

Protein Sequence

MSKGKVWLVGAGPGDASLITVKGLHCIRHAEVLVHDRLVNPELIACAPADCKIINVGKTPNHHPVPQEEINAILVKYAAEGKNVVRLKGGDPYVFGRGGEEAESLAENGLDFEVIPGISSSIGGLAYAGIPVTHRDHASSFHVVTGHMCQGNEPQNWNALAALNGTLVILMGMTRLAEISQLLIDGGKSPDTPAAVVMYASQQRQQVVTATLATLPEEAARHKLHPPALIVVGNVVNLHQILAFAATQIDITQEAPLEAAS

Flanking regions ( +/- flanking 50bp)

AAATGATGTGATTTTTTCATGTTGATTAATCTGATTGATAAGGCAATAAAATGAGCAAAGGTAAAGTATGGCTGGTCGGAGCCGGACCCGGAGATGCATCATTAATTACCGTAAAGGGACTTCACTGTATACGTCATGCCGAAGTGCTGGTGCATGACCGTCTTGTCAATCCTGAGCTGATCGCCTGTGCACCGGCGGACTGCAAAATCATCAATGTCGGTAAAACACCGAATCACCATCCGGTGCCGCAGGAAGAAATCAATGCCATCCTGGTGAAATATGCCGCAGAAGGCAAAAATGTTGTGCGCCTGAAAGGCGGGGATCCGTATGTGTTCGGCCGCGGCGGCGAAGAAGCGGAATCTCTGGCCGAAAACGGCCTCGATTTTGAGGTTATCCCGGGCATCAGTTCCTCTATCGGCGGGCTGGCGTATGCGGGGATCCCGGTGACTCACCGCGATCACGCATCAAGCTTCCATGTGGTCACCGGCCATATGTGTCAGGGGAATGAGCCGCAGAACTGGAATGCACTCGCTGCCCTTAACGGCACACTGGTGATTCTGATGGGGATGACCCGCCTGGCCGAAATCAGTCAGTTGCTGATCGACGGCGGAAAATCACCGGATACCCCGGCTGCCGTGGTCATGTATGCCAGCCAGCAGCGCCAGCAGGTGGTTACTGCCACCCTTGCCACTTTACCGGAAGAGGCTGCGCGTCATAAATTACATCCGCCGGCACTGATTGTCGTTGGTAATGTGGTGAATCTGCACCAGATTCTGGCATTTGCGGCCACACAAATTGATATTACGCAGGAAGCCCCATTAGAAGCTGCGTCATAGTATTATCCTTAAAATAATAAGCATCCGGCTGTATGCAGGTGATACTGTGT