Homologs in group_76

Help

12 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11110 FBDBKF_11110 59.6 Morganella morganii S1 deoD purine-nucleoside phosphorylase
FBDBKF_17750 FBDBKF_17750 100.0 Morganella morganii S1 deoD purine-nucleoside phosphorylase
EHELCC_05115 EHELCC_05115 59.6 Morganella morganii S2 deoD purine-nucleoside phosphorylase
EHELCC_09775 EHELCC_09775 100.0 Morganella morganii S2 deoD purine-nucleoside phosphorylase
NLDBIP_05435 NLDBIP_05435 59.6 Morganella morganii S4 deoD purine-nucleoside phosphorylase
NLDBIP_10155 NLDBIP_10155 100.0 Morganella morganii S4 deoD purine-nucleoside phosphorylase
LHKJJB_02315 LHKJJB_02315 59.6 Morganella morganii S3 deoD purine-nucleoside phosphorylase
HKOGLL_07150 HKOGLL_07150 100.0 Morganella morganii S5 deoD purine-nucleoside phosphorylase
HKOGLL_15695 HKOGLL_15695 59.6 Morganella morganii S5 deoD purine-nucleoside phosphorylase
F4V73_RS08160 F4V73_RS08160 58.7 Morganella psychrotolerans deoD purine-nucleoside phosphorylase
F4V73_RS15215 F4V73_RS15215 94.6 Morganella psychrotolerans deoD purine-nucleoside phosphorylase
PMI_RS11940 PMI_RS11940 83.6 Proteus mirabilis HI4320 deoD purine-nucleoside phosphorylase

Distribution of the homologs in the orthogroup group_76

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_76

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B5Y274 3.11e-153 428 86 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Klebsiella pneumoniae (strain 342)
A7MIG7 6.02e-152 425 86 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Cronobacter sakazakii (strain ATCC BAA-894)
C5BHJ5 1.21e-151 424 86 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Edwardsiella ictaluri (strain 93-146)
Q8KRT5 3.91e-151 423 86 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / CCUG 14189 / LMG 1036 / NCIMB 9965 / AN6)
B1JL34 7.02e-151 422 85 0 237 1 deoD Purine nucleoside phosphorylase DeoD-type Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EV7 7.02e-151 422 85 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K3J1 7.02e-151 422 85 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FMH2 7.02e-151 422 85 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2VH53 2.5e-150 421 85 0 238 3 deoD Purine nucleoside phosphorylase DeoD-type Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6D989 3.08e-150 421 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JJA0 3.86e-150 420 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6DKM0 5.34e-150 420 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A8ALX7 1.43e-149 419 84 0 238 3 deoD Purine nucleoside phosphorylase DeoD-type Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4TQJ0 1.97e-149 418 84 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Yersinia pestis (strain Pestoides F)
Q1CMY7 1.97e-149 418 84 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Yersinia pestis bv. Antiqua (strain Nepal516)
A9R046 1.97e-149 418 84 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIQ2 1.97e-149 418 84 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Yersinia pestis
Q1C166 1.97e-149 418 84 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Yersinia pestis bv. Antiqua (strain Antiqua)
Q8Z0U2 2.98e-149 418 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella typhi
B4TU44 2.98e-149 418 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella schwarzengrund (strain CVM19633)
B5BAK0 2.98e-149 418 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella paratyphi A (strain AKU_12601)
Q5PK20 2.98e-149 418 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T4H3 2.98e-149 418 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella newport (strain SL254)
B5F527 2.98e-149 418 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella agona (strain SL483)
A4W6A1 3.57e-149 418 85 1 240 3 deoD Purine nucleoside phosphorylase DeoD-type Enterobacter sp. (strain 638)
A9MRA4 4.48e-149 417 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A9N7E3 6.09e-149 417 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5R2J9 6.09e-149 417 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella enteritidis PT4 (strain P125109)
B5FTC8 6.09e-149 417 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella dublin (strain CT_02021853)
Q57G38 6.09e-149 417 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella choleraesuis (strain SC-B67)
Q7N930 8.43e-149 417 84 0 238 3 deoD Purine nucleoside phosphorylase DeoD-type Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8ZJV7 1.31e-148 416 83 0 239 1 deoD Purine nucleoside phosphorylase DeoD-type Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TH02 1.31e-148 416 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella heidelberg (strain SL476)
Q3YU09 2.59e-148 416 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Shigella sonnei (strain Ss046)
Q31SV5 2.59e-148 416 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Shigella boydii serotype 4 (strain Sb227)
B2TZR7 2.59e-148 416 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LNS4 2.59e-148 416 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LEI9 2.59e-148 416 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli (strain SMS-3-5 / SECEC)
B6I6N1 2.59e-148 416 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli (strain SE11)
B7NH52 2.59e-148 416 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0ABP8 2.59e-148 416 84 0 239 1 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli (strain K12)
A8A8B3 2.59e-148 416 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O9:H4 (strain HS)
B1XFJ4 2.59e-148 416 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli (strain K12 / DH10B)
C4ZT66 2.59e-148 416 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli (strain K12 / MC4100 / BW2952)
B7LXU6 2.59e-148 416 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O8 (strain IAI1)
B5Z4R6 2.59e-148 416 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0ABP9 2.59e-148 416 84 0 239 1 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O157:H7
B7LEN0 2.59e-148 416 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli (strain 55989 / EAEC)
B7MNJ1 2.59e-148 416 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZVS7 2.59e-148 416 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O139:H28 (strain E24377A / ETEC)
Q83P00 5.22e-148 415 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Shigella flexneri
Q0SX27 5.22e-148 415 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Shigella flexneri serotype 5b (strain 8401)
B1IS35 5.22e-148 415 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8FA51 5.22e-148 415 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0T8S9 5.22e-148 415 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7N2V8 5.22e-148 415 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O81 (strain ED1a)
B7NW64 5.22e-148 415 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7UR12 5.22e-148 415 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q327L2 2.48e-147 413 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Shigella dysenteriae serotype 1 (strain Sd197)
B4EWA1 4.51e-147 412 84 0 235 3 deoD Purine nucleoside phosphorylase DeoD-type Proteus mirabilis (strain HI4320)
B5R9V2 7.92e-147 412 82 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q0I1K5 2.31e-142 400 81 0 235 3 deoD Purine nucleoside phosphorylase DeoD-type Histophilus somni (strain 129Pt)
Q59482 2.37e-141 398 83 2 240 3 deoD Purine nucleoside phosphorylase DeoD-type Klebsiella pneumoniae
P94164 2.56e-141 398 80 0 238 3 deoD Purine nucleoside phosphorylase DeoD-type Actinobacillus pleuropneumoniae
B3H1P6 2.56e-141 398 80 0 238 3 deoD Purine nucleoside phosphorylase DeoD-type Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N122 2.56e-141 398 80 0 238 3 deoD Purine nucleoside phosphorylase DeoD-type Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BPV3 1.33e-140 396 79 0 238 3 deoD Purine nucleoside phosphorylase DeoD-type Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B0UVM2 1.52e-140 396 81 0 235 3 deoD Purine nucleoside phosphorylase DeoD-type Histophilus somni (strain 2336)
B8F672 2.47e-140 395 80 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Glaesserella parasuis serovar 5 (strain SH0165)
Q6LUH1 5.06e-139 392 80 0 237 3 deoD1 Purine nucleoside phosphorylase DeoD-type 1 Photobacterium profundum (strain SS9)
Q9CLE6 2.66e-137 388 79 0 235 3 deoD Purine nucleoside phosphorylase DeoD-type Pasteurella multocida (strain Pm70)
Q87M25 3.32e-137 387 77 0 237 3 deoD1 Purine nucleoside phosphorylase DeoD-type 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A6VM01 6.18e-137 387 78 0 235 3 deoD Purine nucleoside phosphorylase DeoD-type Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
C4LAY8 1.78e-135 383 76 0 235 3 deoD Purine nucleoside phosphorylase DeoD-type Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q65RA4 2.71e-135 383 80 0 236 3 deoD Purine nucleoside phosphorylase DeoD-type Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q5E7J4 8.66e-135 381 75 0 238 3 deoD1 Purine nucleoside phosphorylase DeoD-type 1 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7MI41 1.85e-134 380 77 0 237 3 deoD1 Purine nucleoside phosphorylase DeoD-type 1 Vibrio vulnificus (strain YJ016)
Q8DBS9 1.85e-134 380 77 0 237 3 deoD1 Purine nucleoside phosphorylase DeoD-type 1 Vibrio vulnificus (strain CMCP6)
Q7VMS8 5.34e-134 379 77 0 236 3 deoD Purine nucleoside phosphorylase DeoD-type Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P44417 2.08e-133 378 79 0 235 1 deoD Purine nucleoside phosphorylase DeoD-type Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QN30 2.08e-133 378 79 0 235 3 deoD Purine nucleoside phosphorylase DeoD-type Haemophilus influenzae (strain 86-028NP)
A5UH23 1.34e-132 376 78 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Haemophilus influenzae (strain PittGG)
A5U9X5 3.25e-132 375 78 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Haemophilus influenzae (strain PittEE)
Q9KPM0 9.49e-132 374 76 0 238 1 deoD1 Purine nucleoside phosphorylase DeoD-type 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A1S477 2.91e-127 362 72 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q086F7 3.71e-127 362 73 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Shewanella frigidimarina (strain NCIMB 400)
Q6LLA7 9.81e-126 358 71 0 234 3 deoD2 Purine nucleoside phosphorylase DeoD-type 2 Photobacterium profundum (strain SS9)
A6WRB5 1.28e-125 358 72 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Shewanella baltica (strain OS185)
A3D7J1 1.28e-125 358 72 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q8EHK0 1.36e-125 358 71 0 234 3 deoD2 Purine nucleoside phosphorylase DeoD-type 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q5E0H4 1.68e-125 358 70 0 234 3 deoD2 Purine nucleoside phosphorylase DeoD-type 2 Aliivibrio fischeri (strain ATCC 700601 / ES114)
A3QGT0 2.18e-125 357 73 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B8E6P7 2.21e-125 357 72 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Shewanella baltica (strain OS223)
Q0HXQ1 6.39e-125 356 71 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Shewanella sp. (strain MR-7)
Q0HLE7 6.39e-125 356 71 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Shewanella sp. (strain MR-4)
B6ER81 2.23e-124 355 70 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Aliivibrio salmonicida (strain LFI1238)
A1SYK4 3.06e-124 355 72 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q12QG0 7.11e-124 353 71 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q9KNB2 2.17e-123 352 70 0 234 3 deoD2 Purine nucleoside phosphorylase DeoD-type 2 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q87G42 1.14e-122 350 70 0 234 3 deoD2 Purine nucleoside phosphorylase DeoD-type 2 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MFG6 1.36e-120 345 69 0 234 3 deoD2 Purine nucleoside phosphorylase DeoD-type 2 Vibrio vulnificus (strain YJ016)
Q8D3Z2 1.36e-120 345 69 0 234 3 deoD2 Purine nucleoside phosphorylase DeoD-type 2 Vibrio vulnificus (strain CMCP6)
Q483Q8 1.8e-115 332 65 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q3ICU8 6.65e-110 318 63 0 233 3 deoD Purine nucleoside phosphorylase DeoD-type Pseudoalteromonas translucida (strain TAC 125)
B8D9W3 6.88e-110 318 59 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B8D865 4.42e-109 316 59 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57606 4.42e-109 316 59 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q1D9Z7 8.16e-107 311 63 0 231 3 deoD Purine nucleoside phosphorylase DeoD-type Myxococcus xanthus (strain DK1622)
Q5DYV8 4.68e-103 301 58 0 234 1 deoD3 Purine nucleoside phosphorylase DeoD-type Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7NRT2 1.23e-101 297 60 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q89A58 1.05e-100 295 53 0 235 3 deoD Purine nucleoside phosphorylase DeoD-type Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8EKK0 3.57e-100 294 55 0 234 3 deoD1 Purine nucleoside phosphorylase DeoD-type 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A5EV41 4.75e-100 293 59 0 232 3 deoD Purine nucleoside phosphorylase DeoD-type Dichelobacter nodosus (strain VCS1703A)
Q2SHN2 1.19e-99 292 60 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Hahella chejuensis (strain KCTC 2396)
O34925 7.94e-99 290 59 1 229 1 deoD Purine nucleoside phosphorylase DeoD-type Bacillus subtilis (strain 168)
Q65IE9 7.5e-97 285 58 1 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
C5D2F9 1.77e-96 284 57 1 230 3 deoD Purine nucleoside phosphorylase DeoD-type Geobacillus sp. (strain WCH70)
A7GN01 4.1e-96 283 58 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q5KZM1 1.76e-95 282 58 1 230 3 deoD Purine nucleoside phosphorylase DeoD-type Geobacillus kaustophilus (strain HTA426)
Q63DR9 2.14e-95 281 57 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus (strain ZK / E33L)
A7Z5M8 3.34e-95 281 56 1 229 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B7HHL7 4.12e-95 281 57 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus (strain B4264)
A9VLN1 5.65e-95 280 57 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus mycoides (strain KBAB4)
Q6HL92 5.65e-95 280 57 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus thuringiensis subsp. konkukian (strain 97-27)
B9IVI6 5.65e-95 280 57 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus (strain Q1)
Q5EEL8 5.65e-95 280 57 0 230 1 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus
B7HKX2 5.65e-95 280 57 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus (strain AH187)
C1EMV9 5.65e-95 280 57 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus (strain 03BB102)
B7IP41 5.65e-95 280 57 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus (strain G9842)
Q73B32 5.65e-95 280 57 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JGU6 5.65e-95 280 57 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus (strain AH820)
Q81T09 5.65e-95 280 57 0 230 1 deoD Purine nucleoside phosphorylase DeoD-type Bacillus anthracis
A0RBS0 5.65e-95 280 57 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus thuringiensis (strain Al Hakam)
C3L9J6 5.65e-95 280 57 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P552 5.65e-95 280 57 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus anthracis (strain A0248)
B7GKU4 9.04e-95 280 56 1 230 3 deoD Purine nucleoside phosphorylase DeoD-type Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A0AJW1 1.14e-94 280 58 2 232 3 deoD Purine nucleoside phosphorylase DeoD-type Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q92AF2 1.14e-94 280 58 2 232 3 deoD Purine nucleoside phosphorylase DeoD-type Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8K937 1.15e-94 280 53 0 226 3 deoD Purine nucleoside phosphorylase DeoD-type Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q8Y644 1.37e-94 280 58 2 232 3 deoD Purine nucleoside phosphorylase DeoD-type Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DDP6 1.37e-94 280 58 2 232 3 deoD Purine nucleoside phosphorylase DeoD-type Listeria monocytogenes serotype 4a (strain HCC23)
Q71YG0 1.37e-94 280 58 2 232 3 deoD Purine nucleoside phosphorylase DeoD-type Listeria monocytogenes serotype 4b (strain F2365)
C1KWF5 1.37e-94 280 58 2 232 3 deoD Purine nucleoside phosphorylase DeoD-type Listeria monocytogenes serotype 4b (strain CLIP80459)
Q8ENY0 1.39e-94 280 55 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P77835 1.48e-94 279 56 1 230 1 deoD Purine nucleoside phosphorylase DeoD-type Geobacillus stearothermophilus
Q81FV5 3.63e-94 278 56 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A4IN93 2.25e-93 276 57 1 233 3 deoD Purine nucleoside phosphorylase DeoD-type Geobacillus thermodenitrificans (strain NG80-2)
Q8R973 4.47e-93 276 56 0 227 3 deoD Purine nucleoside phosphorylase DeoD-type Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A0Q1A0 1.18e-92 275 55 0 229 3 deoD Purine nucleoside phosphorylase DeoD-type Clostridium novyi (strain NT)
C0ZDZ3 3.14e-92 273 53 0 231 3 deoD Purine nucleoside phosphorylase DeoD-type Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
B0K6Y4 3.54e-91 271 55 0 227 3 deoD Purine nucleoside phosphorylase DeoD-type Thermoanaerobacter sp. (strain X514)
B0K889 3.54e-91 271 55 0 227 3 deoD Purine nucleoside phosphorylase DeoD-type Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q1CS88 6.32e-91 270 54 0 229 3 deoD Purine nucleoside phosphorylase DeoD-type Helicobacter pylori (strain HPAG1)
B5Z8H2 7.53e-91 270 53 0 229 3 deoD Purine nucleoside phosphorylase DeoD-type Helicobacter pylori (strain G27)
P56463 8.78e-91 270 54 0 229 1 deoD Purine nucleoside phosphorylase DeoD-type Helicobacter pylori (strain ATCC 700392 / 26695)
B2UUU1 1.47e-90 269 54 0 229 3 deoD Purine nucleoside phosphorylase DeoD-type Helicobacter pylori (strain Shi470)
Q9ZK38 2.53e-90 268 54 0 229 3 deoD Purine nucleoside phosphorylase DeoD-type Helicobacter pylori (strain J99 / ATCC 700824)
Q17YP0 2.83e-90 268 53 0 229 3 deoD Purine nucleoside phosphorylase DeoD-type Helicobacter acinonychis (strain Sheeba)
C4L2Y4 1.65e-89 267 56 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B6JN17 1.79e-89 266 53 0 229 3 deoD Purine nucleoside phosphorylase DeoD-type Helicobacter pylori (strain P12)
Q02ZT0 3.1e-89 266 56 2 235 3 deoD Purine nucleoside phosphorylase DeoD-type Lactococcus lactis subsp. cremoris (strain SK11)
O32810 3.1e-89 266 56 2 235 3 deoD Purine nucleoside phosphorylase DeoD-type Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CH10 6.73e-89 265 56 2 235 3 deoD Purine nucleoside phosphorylase DeoD-type Lactococcus lactis subsp. lactis (strain IL1403)
B1YJP1 2.85e-88 263 55 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A6M0X2 1.05e-87 262 55 0 229 3 deoD Purine nucleoside phosphorylase DeoD-type Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A6TVU0 1.4e-87 261 53 0 227 3 deoD Purine nucleoside phosphorylase DeoD-type Alkaliphilus metalliredigens (strain QYMF)
Q8EDM4 2.02e-86 259 53 0 232 1 deoD3 Purine nucleoside phosphorylase DeoD-type Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q28U96 1.55e-85 256 53 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Jannaschia sp. (strain CCS1)
B2G592 4.06e-85 255 56 2 235 3 deoD Purine nucleoside phosphorylase DeoD-type Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VHR2 4.06e-85 255 56 2 235 3 deoD Purine nucleoside phosphorylase DeoD-type Limosilactobacillus reuteri (strain DSM 20016)
Q0ST47 5.17e-85 255 50 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Clostridium perfringens (strain SM101 / Type A)
Q894Z3 9.84e-85 254 53 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Clostridium tetani (strain Massachusetts / E88)
Q0TQJ7 1.37e-84 254 50 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A2RF09 6.89e-80 242 51 1 234 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pyogenes serotype M5 (strain Manfredo)
Q169T2 2.33e-76 233 50 0 232 3 deoD Purine nucleoside phosphorylase DeoD-type Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q1J733 3.77e-76 233 52 1 234 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JM69 2.4e-75 231 51 1 234 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JC85 2.4e-75 231 51 1 234 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pyogenes serotype M12 (strain MGAS2096)
A8LJI8 1.57e-74 228 51 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q38XI0 6.48e-74 227 51 2 231 3 deoD Purine nucleoside phosphorylase DeoD-type Latilactobacillus sakei subsp. sakei (strain 23K)
Q03Q52 8.14e-74 227 48 2 229 3 deoD Purine nucleoside phosphorylase DeoD-type Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B9DUK0 1.67e-73 226 50 1 234 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q03CD2 1.76e-73 226 49 2 229 3 deoD Purine nucleoside phosphorylase DeoD-type Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3W8N4 1.76e-73 226 49 2 229 3 deoD Purine nucleoside phosphorylase DeoD-type Lacticaseibacillus casei (strain BL23)
A4VWC2 6.59e-73 224 48 3 234 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus suis (strain 05ZYH33)
A4W2M2 6.59e-73 224 48 3 234 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus suis (strain 98HAH33)
O83716 1.37e-72 224 47 1 230 3 deoD Purine nucleoside phosphorylase DeoD-type Treponema pallidum (strain Nichols)
Q03KK1 1.57e-68 213 47 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
A8AXN4 5.66e-68 212 47 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
C1CDI3 2.12e-67 211 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pneumoniae (strain JJA)
C1CJS5 9.61e-67 209 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pneumoniae (strain P1031)
B8ZNN8 9.61e-67 209 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1C6H0 9.61e-67 209 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pneumoniae (strain 70585)
B5E3K8 9.61e-67 209 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pneumoniae serotype 19F (strain G54)
Q04L76 9.61e-67 209 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
C1CS55 4.81e-66 207 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pneumoniae (strain Taiwan19F-14)
B2INV3 4.81e-66 207 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pneumoniae (strain CGSP14)
B1IB05 5.54e-66 207 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pneumoniae (strain Hungary19A-6)
P75053 3.38e-63 200 45 2 231 3 deoD Purine nucleoside phosphorylase DeoD-type Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47295 1.32e-57 186 45 2 235 3 deoD Purine nucleoside phosphorylase DeoD-type Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q56037 2.3e-57 184 46 1 214 3 deoD Purine nucleoside phosphorylase DeoD-type (Fragment) Streptococcus thermophilus
B9LS20 2.39e-29 113 30 5 238 1 Hlac_2318 Guanosine phosphorylase Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34)
P50389 3.53e-28 110 33 4 212 1 SSO2706 Purine nucleoside phosphorylase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q5JJC1 1.77e-21 93 30 5 242 3 udp Uridine phosphorylase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P0A1F6 1.86e-19 87 28 9 246 1 udp Uridine phosphorylase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1F7 1.86e-19 87 28 9 246 3 udp Uridine phosphorylase Salmonella typhi
O08444 4.52e-19 86 28 9 246 3 udp Uridine phosphorylase Klebsiella aerogenes
P12758 1.7e-18 84 28 9 246 1 udp Uridine phosphorylase Escherichia coli (strain K12)
O83990 9.47e-17 80 30 6 194 3 udp Uridine phosphorylase Treponema pallidum (strain Nichols)
P43770 1.03e-16 80 26 7 229 3 udp Uridine phosphorylase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5K9M4 3.1e-14 73 29 6 188 1 PNP Purine nucleoside phosphorylase Plasmodium vivax (strain Salvador I)
Q8T9Z7 2.5e-12 67 28 7 189 1 PNP Purine nucleoside phosphorylase Plasmodium falciparum
Q8I3X4 2.5e-12 67 28 7 189 1 PNP Purine nucleoside phosphorylase Plasmodium falciparum (isolate 3D7)
Q9KDD4 3.41e-09 58 26 5 197 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A1IGA8 8.25e-08 54 26 5 196 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Aliivibrio fischeri
B5FAL1 9.35e-08 54 26 5 196 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Aliivibrio fischeri (strain MJ11)
Q5E2X3 9.35e-08 54 26 5 196 1 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A7MGS5 2.26e-07 53 23 3 215 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Cronobacter sakazakii (strain ATCC BAA-894)
Q4QL83 7.35e-07 52 23 5 215 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Haemophilus influenzae (strain 86-028NP)
A5UIX8 1.38e-06 51 23 5 215 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Haemophilus influenzae (strain PittGG)
Q6LUR4 3.87e-06 50 24 5 211 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Photobacterium profundum (strain SS9)
A5UCP4 5.53e-06 49 23 5 215 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Haemophilus influenzae (strain PittEE)
B0URX4 5.59e-06 49 24 5 209 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Histophilus somni (strain 2336)
P45113 6.03e-06 49 23 5 215 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
C3LQF1 1.13e-05 48 23 6 221 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Vibrio cholerae serotype O1 (strain M66-2)
Q9KPI8 1.13e-05 48 23 6 221 1 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5R2 1.13e-05 48 23 6 221 1 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q2NVP7 1.18e-05 48 23 5 200 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Sodalis glossinidius (strain morsitans)
P47724 1.32e-05 44 60 0 35 3 deoD Purine nucleoside phosphorylase DeoD-type (Fragment) Mycoplasmoides pirum
Q6AQW7 2.67e-05 47 23 4 176 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q7N841 2.73e-05 47 24 5 213 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6VPH1 3.11e-05 47 25 5 188 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q8CP08 6.04e-05 46 21 4 188 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNU8 6.04e-05 46 21 4 188 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q0I5K4 8.05e-05 46 22 6 218 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Histophilus somni (strain 129Pt)
B6EKZ7 8.46e-05 45 25 5 200 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Aliivibrio salmonicida (strain LFI1238)
A0KIZ1 8.49e-05 45 25 7 207 1 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q7VKK0 9.61e-05 45 24 4 186 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q7A0R5 9.65e-05 45 24 4 173 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain MW2)
A8Z4D8 9.65e-05 45 24 4 173 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G8W9 9.65e-05 45 24 4 173 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain MSSA476)
Q7A5B0 9.65e-05 45 24 4 173 1 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain N315)
Q99TQ0 9.65e-05 45 24 4 173 1 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QHE1 9.65e-05 45 24 4 173 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain Newman)
Q5HFG2 9.65e-05 45 24 4 173 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain COL)
A5ITC6 9.65e-05 45 24 4 173 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain JH9)
Q2FXX8 9.65e-05 45 24 4 173 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FGC5 9.65e-05 45 24 4 173 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain USA300)
A6U271 9.65e-05 45 24 4 173 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain JH1)
A7X306 9.65e-05 45 24 4 173 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6GGA2 0.000122 45 24 4 173 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain MRSA252)
Q2YT29 0.000125 45 24 4 173 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain bovine RF122 / ET3-1)
B8F704 0.000165 45 23 5 215 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Glaesserella parasuis serovar 5 (strain SH0165)
B2VE28 0.00017 45 22 7 226 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B7LWC0 0.000215 44 22 4 208 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q8EPT8 0.00029 44 23 5 212 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B4EUF0 0.000478 43 22 4 191 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Proteus mirabilis (strain HI4320)
Q7MNT0 0.000518 43 24 5 202 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Vibrio vulnificus (strain YJ016)
Q65SB6 0.000678 43 24 4 168 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8DEM9 0.000711 43 24 5 202 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Vibrio vulnificus (strain CMCP6)
Q1LTN6 0.00073 43 20 3 164 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q12KE6 0.000762 43 26 5 182 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A4SP53 0.000884 43 24 7 207 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Aeromonas salmonicida (strain A449)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_07600
Feature type CDS
Gene deoD
Product purine-nucleoside phosphorylase
Location 26308 - 27027 (strand: 1)
Length 720 (nucleotides) / 239 (amino acids)

Contig

Accession ZDB_364
Length 217237 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_76
Orthogroup size 13
N. genomes 7

Actions

Genomic region

Domains

PF01048 Phosphorylase superfamily

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0813 Nucleotide transport and metabolism (F) F Purine-nucleoside phosphorylase

Kegg Ortholog Annotation(s)

Protein Sequence

MATPHINAERGDFADVVLMPGDPLRAKYIAENFLEDIKQVNNVRGMLGFTGTYKGRRISVMGHGMGIPSCSIYAKELITEFDVKTIIRVGSCGAISRDVKLRDVVIGMGASTDSKVNRLRFKDNDFAAIADFGLVRNAVEAAETAGIPARVGNIFSADLFYTPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTGENLPAEERQTTFNEMITIALESVLLGDKK

Flanking regions ( +/- flanking 50bp)

CAGGCTTTCAGTCTGCCCTTTCCCTTTGGATTGACTGAAAGGATTTTTTTATGGCTACCCCTCACATTAATGCCGAACGCGGTGATTTTGCTGATGTTGTTCTGATGCCCGGCGACCCGCTGCGCGCGAAATACATTGCAGAAAATTTTCTGGAAGATATTAAACAAGTCAACAATGTGCGTGGCATGCTGGGTTTTACCGGAACCTATAAAGGCCGCCGTATCTCCGTGATGGGCCACGGTATGGGGATCCCGTCCTGCTCTATTTATGCCAAAGAGCTGATCACTGAATTTGACGTGAAAACCATTATCCGCGTCGGTTCCTGCGGGGCTATCAGCCGTGATGTCAAACTGCGTGATGTGGTTATCGGCATGGGCGCGAGCACGGATTCCAAAGTGAACCGTCTGCGTTTCAAGGATAACGATTTCGCGGCTATCGCGGACTTCGGGCTGGTACGTAATGCGGTTGAAGCGGCAGAAACCGCCGGGATCCCGGCGCGTGTCGGTAATATCTTCTCTGCGGATTTATTCTATACACCGGATCCGCAAATGTTTGACGTGATGGAAAAATACGGCATTCTGGGCGTGGAAATGGAAGCTGCCGGTATTTATGGTGTGGCTGCTGAATTCGGTGCAAAAGCACTGACTATCTGCACCGTTTCTGACCATATCCGTACCGGTGAAAATTTACCGGCAGAAGAGCGCCAGACTACTTTTAATGAAATGATCACTATCGCGCTGGAATCTGTTTTACTGGGCGATAAGAAGTAATTTATTTCAGTCATTATAAAAACCGCTGCCGGTATTATTTTCCGGCAGCG