Homologs in group_76

Help

12 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11110 FBDBKF_11110 60.9 Morganella morganii S1 deoD purine-nucleoside phosphorylase
FBDBKF_17750 FBDBKF_17750 94.6 Morganella morganii S1 deoD purine-nucleoside phosphorylase
EHELCC_05115 EHELCC_05115 60.9 Morganella morganii S2 deoD purine-nucleoside phosphorylase
EHELCC_09775 EHELCC_09775 94.6 Morganella morganii S2 deoD purine-nucleoside phosphorylase
NLDBIP_05435 NLDBIP_05435 60.9 Morganella morganii S4 deoD purine-nucleoside phosphorylase
NLDBIP_10155 NLDBIP_10155 94.6 Morganella morganii S4 deoD purine-nucleoside phosphorylase
LHKJJB_02315 LHKJJB_02315 60.9 Morganella morganii S3 deoD purine-nucleoside phosphorylase
LHKJJB_07600 LHKJJB_07600 94.6 Morganella morganii S3 deoD purine-nucleoside phosphorylase
HKOGLL_07150 HKOGLL_07150 94.6 Morganella morganii S5 deoD purine-nucleoside phosphorylase
HKOGLL_15695 HKOGLL_15695 60.9 Morganella morganii S5 deoD purine-nucleoside phosphorylase
F4V73_RS08160 F4V73_RS08160 60.0 Morganella psychrotolerans deoD purine-nucleoside phosphorylase
PMI_RS11940 PMI_RS11940 83.2 Proteus mirabilis HI4320 deoD purine-nucleoside phosphorylase

Distribution of the homologs in the orthogroup group_76

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_76

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B5Y274 1.78e-151 424 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Klebsiella pneumoniae (strain 342)
Q6D989 8.09e-151 422 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MIG7 9.97e-151 422 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Cronobacter sakazakii (strain ATCC BAA-894)
C6DKM0 9.13e-150 419 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A1JJA0 1.12e-149 419 84 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C5BHJ5 1.6e-149 419 85 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Edwardsiella ictaluri (strain 93-146)
B1JL34 1.92e-149 419 83 0 237 1 deoD Purine nucleoside phosphorylase DeoD-type Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EV7 1.92e-149 419 83 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K3J1 1.92e-149 419 83 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FMH2 1.92e-149 419 83 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q8KRT5 8.62e-149 417 83 0 238 3 deoD Purine nucleoside phosphorylase DeoD-type Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / CCUG 14189 / LMG 1036 / NCIMB 9965 / AN6)
B2VH53 1.02e-148 417 84 0 238 3 deoD Purine nucleoside phosphorylase DeoD-type Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q3YU09 3.76e-148 415 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Shigella sonnei (strain Ss046)
Q31SV5 3.76e-148 415 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Shigella boydii serotype 4 (strain Sb227)
B2TZR7 3.76e-148 415 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LNS4 3.76e-148 415 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LEI9 3.76e-148 415 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli (strain SMS-3-5 / SECEC)
B6I6N1 3.76e-148 415 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli (strain SE11)
B7NH52 3.76e-148 415 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0ABP8 3.76e-148 415 83 0 239 1 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli (strain K12)
A8A8B3 3.76e-148 415 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O9:H4 (strain HS)
B1XFJ4 3.76e-148 415 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli (strain K12 / DH10B)
C4ZT66 3.76e-148 415 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli (strain K12 / MC4100 / BW2952)
B7LXU6 3.76e-148 415 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O8 (strain IAI1)
B5Z4R6 3.76e-148 415 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0ABP9 3.76e-148 415 83 0 239 1 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O157:H7
B7LEN0 3.76e-148 415 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli (strain 55989 / EAEC)
B7MNJ1 3.76e-148 415 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZVS7 3.76e-148 415 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O139:H28 (strain E24377A / ETEC)
Q7N930 4.87e-148 415 83 0 238 3 deoD Purine nucleoside phosphorylase DeoD-type Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A4TQJ0 6.94e-148 414 83 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Yersinia pestis (strain Pestoides F)
Q1CMY7 6.94e-148 414 83 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Yersinia pestis bv. Antiqua (strain Nepal516)
A9R046 6.94e-148 414 83 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIQ2 6.94e-148 414 83 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Yersinia pestis
Q1C166 6.94e-148 414 83 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Yersinia pestis bv. Antiqua (strain Antiqua)
Q83P00 7.75e-148 414 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Shigella flexneri
Q0SX27 7.75e-148 414 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Shigella flexneri serotype 5b (strain 8401)
B1IS35 7.75e-148 414 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8FA51 7.75e-148 414 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0T8S9 7.75e-148 414 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7N2V8 7.75e-148 414 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O81 (strain ED1a)
B7NW64 7.75e-148 414 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7UR12 7.75e-148 414 83 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q8Z0U2 1.34e-147 414 82 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella typhi
B4TU44 1.34e-147 414 82 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella schwarzengrund (strain CVM19633)
B5BAK0 1.34e-147 414 82 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella paratyphi A (strain AKU_12601)
Q5PK20 1.34e-147 414 82 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T4H3 1.34e-147 414 82 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella newport (strain SL254)
B5F527 1.34e-147 414 82 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella agona (strain SL483)
B4EWA1 1.63e-147 414 84 0 235 3 deoD Purine nucleoside phosphorylase DeoD-type Proteus mirabilis (strain HI4320)
A8ALX7 1.63e-147 414 83 0 238 3 deoD Purine nucleoside phosphorylase DeoD-type Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4W6A1 2.4e-147 413 83 1 240 3 deoD Purine nucleoside phosphorylase DeoD-type Enterobacter sp. (strain 638)
Q327L2 2.65e-147 413 82 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Shigella dysenteriae serotype 1 (strain Sd197)
A9MRA4 3.08e-147 413 82 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A9N7E3 4.43e-147 412 82 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5R2J9 4.43e-147 412 82 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella enteritidis PT4 (strain P125109)
B5FTC8 4.43e-147 412 82 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella dublin (strain CT_02021853)
Q57G38 4.43e-147 412 82 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella choleraesuis (strain SC-B67)
Q8ZJV7 6.22e-147 412 82 0 239 1 deoD Purine nucleoside phosphorylase DeoD-type Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TH02 6.22e-147 412 82 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella heidelberg (strain SL476)
B5R9V2 5.28e-145 407 81 0 239 3 deoD Purine nucleoside phosphorylase DeoD-type Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q59482 4.77e-140 395 81 2 240 3 deoD Purine nucleoside phosphorylase DeoD-type Klebsiella pneumoniae
P94164 1.53e-139 394 79 0 238 3 deoD Purine nucleoside phosphorylase DeoD-type Actinobacillus pleuropneumoniae
B3H1P6 1.53e-139 394 79 0 238 3 deoD Purine nucleoside phosphorylase DeoD-type Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N122 1.53e-139 394 79 0 238 3 deoD Purine nucleoside phosphorylase DeoD-type Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BPV3 3.88e-139 392 78 0 238 3 deoD Purine nucleoside phosphorylase DeoD-type Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q0I1K5 1.08e-138 391 78 0 235 3 deoD Purine nucleoside phosphorylase DeoD-type Histophilus somni (strain 129Pt)
Q87M25 1.65e-138 391 77 0 239 3 deoD1 Purine nucleoside phosphorylase DeoD-type 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6LUH1 7.11e-138 389 79 0 237 3 deoD1 Purine nucleoside phosphorylase DeoD-type 1 Photobacterium profundum (strain SS9)
B8F672 3.14e-137 387 78 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Glaesserella parasuis serovar 5 (strain SH0165)
B0UVM2 5.3e-137 387 78 0 235 3 deoD Purine nucleoside phosphorylase DeoD-type Histophilus somni (strain 2336)
A6VM01 1.59e-136 386 78 0 235 3 deoD Purine nucleoside phosphorylase DeoD-type Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q5E7J4 4.25e-136 385 76 0 238 3 deoD1 Purine nucleoside phosphorylase DeoD-type 1 Aliivibrio fischeri (strain ATCC 700601 / ES114)
C4LAY8 7.55e-135 381 75 0 235 3 deoD Purine nucleoside phosphorylase DeoD-type Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q7MI41 4.75e-134 380 75 0 239 3 deoD1 Purine nucleoside phosphorylase DeoD-type 1 Vibrio vulnificus (strain YJ016)
Q8DBS9 4.75e-134 380 75 0 239 3 deoD1 Purine nucleoside phosphorylase DeoD-type 1 Vibrio vulnificus (strain CMCP6)
Q9CLE6 5.23e-134 379 77 0 235 3 deoD Purine nucleoside phosphorylase DeoD-type Pasteurella multocida (strain Pm70)
Q65RA4 2.19e-132 375 78 0 236 3 deoD Purine nucleoside phosphorylase DeoD-type Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9KPM0 3.7e-132 375 75 0 238 1 deoD1 Purine nucleoside phosphorylase DeoD-type 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7VMS8 4.09e-131 372 74 0 236 3 deoD Purine nucleoside phosphorylase DeoD-type Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A5UH23 1.57e-129 368 76 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Haemophilus influenzae (strain PittGG)
P44417 1.72e-129 368 77 0 235 1 deoD Purine nucleoside phosphorylase DeoD-type Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QN30 1.72e-129 368 77 0 235 3 deoD Purine nucleoside phosphorylase DeoD-type Haemophilus influenzae (strain 86-028NP)
A5U9X5 4.26e-129 367 76 0 237 3 deoD Purine nucleoside phosphorylase DeoD-type Haemophilus influenzae (strain PittEE)
Q086F7 1.59e-127 363 73 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Shewanella frigidimarina (strain NCIMB 400)
Q12QG0 9.62e-127 361 73 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q6LLA7 4.46e-126 359 72 0 234 3 deoD2 Purine nucleoside phosphorylase DeoD-type 2 Photobacterium profundum (strain SS9)
A3QGT0 9.39e-126 358 73 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1S477 9.81e-126 358 71 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q5E0H4 1.08e-125 358 70 0 234 3 deoD2 Purine nucleoside phosphorylase DeoD-type 2 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6ER81 2.38e-125 357 71 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Aliivibrio salmonicida (strain LFI1238)
A1SYK4 5.79e-125 357 73 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q0HXQ1 3.03e-124 355 70 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Shewanella sp. (strain MR-7)
Q0HLE7 3.03e-124 355 70 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Shewanella sp. (strain MR-4)
Q8EHK0 8.02e-124 353 70 0 234 3 deoD2 Purine nucleoside phosphorylase DeoD-type 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9KNB2 3.44e-123 352 70 0 234 3 deoD2 Purine nucleoside phosphorylase DeoD-type 2 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A6WRB5 4.63e-123 352 70 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Shewanella baltica (strain OS185)
A3D7J1 4.63e-123 352 70 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E6P7 8.55e-123 351 70 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Shewanella baltica (strain OS223)
Q87G42 3.4e-122 349 70 0 234 3 deoD2 Purine nucleoside phosphorylase DeoD-type 2 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MFG6 5.13e-120 344 69 0 234 3 deoD2 Purine nucleoside phosphorylase DeoD-type 2 Vibrio vulnificus (strain YJ016)
Q8D3Z2 5.13e-120 344 69 0 234 3 deoD2 Purine nucleoside phosphorylase DeoD-type 2 Vibrio vulnificus (strain CMCP6)
Q483Q8 3.26e-116 334 66 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q3ICU8 1.08e-111 323 64 0 233 3 deoD Purine nucleoside phosphorylase DeoD-type Pseudoalteromonas translucida (strain TAC 125)
B8D865 1.69e-109 317 60 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57606 1.69e-109 317 60 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9W3 5.51e-109 316 60 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q1D9Z7 1.43e-106 310 62 0 231 3 deoD Purine nucleoside phosphorylase DeoD-type Myxococcus xanthus (strain DK1622)
Q5DYV8 6.53e-104 303 58 0 234 1 deoD3 Purine nucleoside phosphorylase DeoD-type Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7NRT2 2.53e-103 301 60 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A5EV41 2.44e-100 294 58 0 232 3 deoD Purine nucleoside phosphorylase DeoD-type Dichelobacter nodosus (strain VCS1703A)
Q89A58 9.68e-100 293 53 0 235 3 deoD Purine nucleoside phosphorylase DeoD-type Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q2SHN2 3.87e-99 291 59 0 234 3 deoD Purine nucleoside phosphorylase DeoD-type Hahella chejuensis (strain KCTC 2396)
Q8EKK0 7.22e-99 290 54 0 234 3 deoD1 Purine nucleoside phosphorylase DeoD-type 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q5KZM1 5.61e-97 286 56 1 230 3 deoD Purine nucleoside phosphorylase DeoD-type Geobacillus kaustophilus (strain HTA426)
Q8K937 1.89e-96 284 56 0 226 3 deoD Purine nucleoside phosphorylase DeoD-type Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A4IN93 1.04e-95 282 56 1 233 3 deoD Purine nucleoside phosphorylase DeoD-type Geobacillus thermodenitrificans (strain NG80-2)
O34925 2.11e-95 281 57 1 229 1 deoD Purine nucleoside phosphorylase DeoD-type Bacillus subtilis (strain 168)
A7GN01 5.65e-95 280 56 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
C5D2F9 6.17e-95 280 56 1 230 3 deoD Purine nucleoside phosphorylase DeoD-type Geobacillus sp. (strain WCH70)
Q63DR9 6.52e-95 280 56 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus (strain ZK / E33L)
B7HHL7 9.45e-95 280 56 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus (strain B4264)
A9VLN1 1.42e-94 280 56 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus mycoides (strain KBAB4)
Q6HL92 1.42e-94 280 56 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus thuringiensis subsp. konkukian (strain 97-27)
B9IVI6 1.42e-94 280 56 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus (strain Q1)
Q5EEL8 1.42e-94 280 56 0 230 1 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus
B7HKX2 1.42e-94 280 56 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus (strain AH187)
C1EMV9 1.42e-94 280 56 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus (strain 03BB102)
B7IP41 1.42e-94 280 56 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus (strain G9842)
Q73B32 1.42e-94 280 56 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JGU6 1.42e-94 280 56 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus (strain AH820)
Q81T09 1.42e-94 280 56 0 230 1 deoD Purine nucleoside phosphorylase DeoD-type Bacillus anthracis
A0RBS0 1.42e-94 280 56 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus thuringiensis (strain Al Hakam)
C3L9J6 1.42e-94 280 56 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P552 1.42e-94 280 56 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus anthracis (strain A0248)
Q8R973 1.59e-94 279 56 0 227 3 deoD Purine nucleoside phosphorylase DeoD-type Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q65IE9 7.86e-94 277 56 1 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q81FV5 8.79e-94 277 56 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q1CS88 2.6e-92 274 54 0 229 3 deoD Purine nucleoside phosphorylase DeoD-type Helicobacter pylori (strain HPAG1)
A0Q1A0 2.72e-92 273 55 0 229 3 deoD Purine nucleoside phosphorylase DeoD-type Clostridium novyi (strain NT)
A7Z5M8 2.84e-92 273 54 1 229 3 deoD Purine nucleoside phosphorylase DeoD-type Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B5Z8H2 2.84e-92 273 54 0 229 3 deoD Purine nucleoside phosphorylase DeoD-type Helicobacter pylori (strain G27)
P56463 3.38e-92 273 55 0 229 1 deoD Purine nucleoside phosphorylase DeoD-type Helicobacter pylori (strain ATCC 700392 / 26695)
B2UUU1 4.91e-92 273 54 0 229 3 deoD Purine nucleoside phosphorylase DeoD-type Helicobacter pylori (strain Shi470)
B7GKU4 5.65e-92 273 54 1 230 3 deoD Purine nucleoside phosphorylase DeoD-type Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A0AJW1 5.9e-92 273 56 2 232 3 deoD Purine nucleoside phosphorylase DeoD-type Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q92AF2 5.9e-92 273 56 2 232 3 deoD Purine nucleoside phosphorylase DeoD-type Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8Y644 7.93e-92 272 56 2 232 3 deoD Purine nucleoside phosphorylase DeoD-type Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DDP6 7.93e-92 272 56 2 232 3 deoD Purine nucleoside phosphorylase DeoD-type Listeria monocytogenes serotype 4a (strain HCC23)
Q71YG0 7.93e-92 272 56 2 232 3 deoD Purine nucleoside phosphorylase DeoD-type Listeria monocytogenes serotype 4b (strain F2365)
C1KWF5 7.93e-92 272 56 2 232 3 deoD Purine nucleoside phosphorylase DeoD-type Listeria monocytogenes serotype 4b (strain CLIP80459)
Q9ZK38 8.47e-92 272 54 0 229 3 deoD Purine nucleoside phosphorylase DeoD-type Helicobacter pylori (strain J99 / ATCC 700824)
Q17YP0 9.65e-92 272 53 0 229 3 deoD Purine nucleoside phosphorylase DeoD-type Helicobacter acinonychis (strain Sheeba)
P77835 9.66e-92 272 54 1 230 1 deoD Purine nucleoside phosphorylase DeoD-type Geobacillus stearothermophilus
Q8ENY0 1.42e-91 272 54 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
C0ZDZ3 1.97e-91 271 52 0 231 3 deoD Purine nucleoside phosphorylase DeoD-type Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
B0K6Y4 2.88e-91 271 54 0 227 3 deoD Purine nucleoside phosphorylase DeoD-type Thermoanaerobacter sp. (strain X514)
B0K889 2.88e-91 271 54 0 227 3 deoD Purine nucleoside phosphorylase DeoD-type Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B6JN17 8.4e-91 270 53 0 229 3 deoD Purine nucleoside phosphorylase DeoD-type Helicobacter pylori (strain P12)
C4L2Y4 2.23e-90 269 56 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A6TVU0 2.41e-89 266 54 0 227 3 deoD Purine nucleoside phosphorylase DeoD-type Alkaliphilus metalliredigens (strain QYMF)
B1YJP1 6.44e-89 265 54 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A6M0X2 1.52e-87 262 55 0 229 3 deoD Purine nucleoside phosphorylase DeoD-type Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
B2G592 6.99e-87 260 55 2 235 3 deoD Purine nucleoside phosphorylase DeoD-type Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VHR2 6.99e-87 260 55 2 235 3 deoD Purine nucleoside phosphorylase DeoD-type Limosilactobacillus reuteri (strain DSM 20016)
Q28U96 1.08e-86 259 53 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Jannaschia sp. (strain CCS1)
Q8EDM4 1.47e-86 259 53 0 232 1 deoD3 Purine nucleoside phosphorylase DeoD-type Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q02ZT0 1.91e-86 259 55 2 235 3 deoD Purine nucleoside phosphorylase DeoD-type Lactococcus lactis subsp. cremoris (strain SK11)
O32810 1.91e-86 259 55 2 235 3 deoD Purine nucleoside phosphorylase DeoD-type Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CH10 3.76e-86 258 55 2 235 3 deoD Purine nucleoside phosphorylase DeoD-type Lactococcus lactis subsp. lactis (strain IL1403)
Q0ST47 4.52e-86 258 50 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Clostridium perfringens (strain SM101 / Type A)
Q0TQJ7 1.32e-85 257 50 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q894Z3 1.66e-84 254 52 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Clostridium tetani (strain Massachusetts / E88)
A2RF09 2.5e-80 243 50 1 234 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pyogenes serotype M5 (strain Manfredo)
A8LJI8 3.78e-78 238 54 0 230 3 deoD Purine nucleoside phosphorylase DeoD-type Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q169T2 3.24e-77 235 49 0 232 3 deoD Purine nucleoside phosphorylase DeoD-type Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q1J733 1.51e-76 234 51 1 234 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q03Q52 3.06e-76 233 49 2 229 3 deoD Purine nucleoside phosphorylase DeoD-type Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q1JM69 8.82e-76 232 50 1 234 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JC85 8.82e-76 232 50 1 234 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pyogenes serotype M12 (strain MGAS2096)
B9DUK0 1.08e-74 229 49 1 234 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus uberis (strain ATCC BAA-854 / 0140J)
O83716 1.93e-74 228 48 1 230 3 deoD Purine nucleoside phosphorylase DeoD-type Treponema pallidum (strain Nichols)
Q38XI0 3.48e-74 228 51 2 231 3 deoD Purine nucleoside phosphorylase DeoD-type Latilactobacillus sakei subsp. sakei (strain 23K)
Q03CD2 1.72e-73 226 50 2 229 3 deoD Purine nucleoside phosphorylase DeoD-type Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3W8N4 1.72e-73 226 50 2 229 3 deoD Purine nucleoside phosphorylase DeoD-type Lacticaseibacillus casei (strain BL23)
A4VWC2 3.31e-72 223 47 3 234 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus suis (strain 05ZYH33)
A4W2M2 3.31e-72 223 47 3 234 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus suis (strain 98HAH33)
C1CDI3 7.61e-68 212 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pneumoniae (strain JJA)
Q03KK1 1.88e-67 211 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
C1CS55 5.4e-67 209 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pneumoniae (strain Taiwan19F-14)
B2INV3 5.4e-67 209 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pneumoniae (strain CGSP14)
C1CJS5 1.19e-66 209 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pneumoniae (strain P1031)
B8ZNN8 1.19e-66 209 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1C6H0 1.19e-66 209 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pneumoniae (strain 70585)
B5E3K8 1.19e-66 209 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pneumoniae serotype 19F (strain G54)
Q04L76 1.19e-66 209 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A8AXN4 1.44e-66 208 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B1IB05 2.06e-66 208 46 1 231 3 deoD Purine nucleoside phosphorylase DeoD-type Streptococcus pneumoniae (strain Hungary19A-6)
P75053 9.63e-61 194 44 2 231 3 deoD Purine nucleoside phosphorylase DeoD-type Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47295 1.07e-59 191 46 2 235 3 deoD Purine nucleoside phosphorylase DeoD-type Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q56037 6.45e-57 183 45 1 214 3 deoD Purine nucleoside phosphorylase DeoD-type (Fragment) Streptococcus thermophilus
B9LS20 1.18e-31 119 32 3 213 1 Hlac_2318 Guanosine phosphorylase Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34)
P50389 1.25e-31 119 34 4 212 1 SSO2706 Purine nucleoside phosphorylase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q5JJC1 3.5e-24 100 32 4 212 3 udp Uridine phosphorylase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P0A1F6 2.76e-20 89 30 7 219 1 udp Uridine phosphorylase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1F7 2.76e-20 89 30 7 219 3 udp Uridine phosphorylase Salmonella typhi
O08444 5.93e-20 88 29 9 236 3 udp Uridine phosphorylase Klebsiella aerogenes
O83990 2.47e-19 87 32 6 194 3 udp Uridine phosphorylase Treponema pallidum (strain Nichols)
P12758 2.49e-19 87 29 9 236 1 udp Uridine phosphorylase Escherichia coli (strain K12)
P43770 3.54e-19 86 27 7 229 3 udp Uridine phosphorylase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5K9M4 1.33e-16 79 30 6 188 1 PNP Purine nucleoside phosphorylase Plasmodium vivax (strain Salvador I)
Q8T9Z7 7.11e-15 74 29 6 188 1 PNP Purine nucleoside phosphorylase Plasmodium falciparum
Q8I3X4 7.11e-15 74 29 6 188 1 PNP Purine nucleoside phosphorylase Plasmodium falciparum (isolate 3D7)
A7MGS5 4.31e-09 58 24 4 210 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Cronobacter sakazakii (strain ATCC BAA-894)
Q9KDD4 4.16e-08 55 25 5 197 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P52671 4.55e-08 55 29 7 161 3 udp Uridine phosphorylase Klebsiella pneumoniae
B5FAL1 9.09e-08 54 27 5 196 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Aliivibrio fischeri (strain MJ11)
Q5E2X3 9.09e-08 54 27 5 196 1 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A1IGA8 9.35e-08 54 27 5 196 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Aliivibrio fischeri
Q2NVP7 2.44e-07 53 23 5 200 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Sodalis glossinidius (strain morsitans)
Q4QL83 9.07e-07 51 25 5 197 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Haemophilus influenzae (strain 86-028NP)
A5UIX8 1.69e-06 50 24 5 197 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Haemophilus influenzae (strain PittGG)
A6VPH1 2.56e-06 50 27 5 188 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A0KIZ1 3.47e-06 50 27 7 207 1 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B0URX4 4.85e-06 49 24 5 199 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Histophilus somni (strain 2336)
P45113 8.16e-06 48 24 5 197 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q6LUR4 8.49e-06 48 25 5 205 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Photobacterium profundum (strain SS9)
B6EKZ7 9.63e-06 48 26 5 200 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Aliivibrio salmonicida (strain LFI1238)
B7LWC0 9.88e-06 48 23 4 208 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B8F704 1.06e-05 48 23 3 200 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Glaesserella parasuis serovar 5 (strain SH0165)
Q0I5K4 1.08e-05 48 24 5 199 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Histophilus somni (strain 129Pt)
C3LQF1 1.28e-05 48 23 7 221 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Vibrio cholerae serotype O1 (strain M66-2)
Q9KPI8 1.28e-05 48 23 7 221 1 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5R2 1.28e-05 48 23 7 221 1 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7N841 1.75e-05 48 23 4 197 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6AQW7 1.78e-05 48 23 4 176 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A5UCP4 1.8e-05 48 24 5 197 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Haemophilus influenzae (strain PittEE)
Q8CP08 4.11e-05 47 21 4 188 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNU8 4.11e-05 47 21 4 188 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A4SP53 4.44e-05 47 26 7 207 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Aeromonas salmonicida (strain A449)
Q1LTN6 5.48e-05 46 21 4 178 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Baumannia cicadellinicola subsp. Homalodisca coagulata
P47724 6.43e-05 42 57 0 35 3 deoD Purine nucleoside phosphorylase DeoD-type (Fragment) Mycoplasmoides pirum
B5Y1L0 8.84e-05 45 23 4 208 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Klebsiella pneumoniae (strain 342)
B2VE28 0.000154 45 22 5 218 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q7A0R5 0.000168 45 23 5 193 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain MW2)
A8Z4D8 0.000168 45 23 5 193 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G8W9 0.000168 45 23 5 193 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain MSSA476)
Q7A5B0 0.000168 45 23 5 193 1 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain N315)
Q99TQ0 0.000168 45 23 5 193 1 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QHE1 0.000168 45 23 5 193 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain Newman)
Q5HFG2 0.000168 45 23 5 193 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain COL)
A5ITC6 0.000168 45 23 5 193 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain JH9)
Q2FXX8 0.000168 45 23 5 193 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FGC5 0.000168 45 23 5 193 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain USA300)
A6U271 0.000168 45 23 5 193 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain JH1)
A7X306 0.000168 45 23 5 193 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6GGA2 0.000212 44 23 5 193 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain MRSA252)
Q2YT29 0.000228 44 23 5 193 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6D1Z4 0.000274 44 22 3 202 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C4L559 0.000291 44 24 4 186 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q8EPT8 0.00038 43 23 4 204 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q12KE6 0.000483 43 26 5 182 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A7MXP2 0.000543 43 24 5 205 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Vibrio campbellii (strain ATCC BAA-1116)
C6DC27 0.000572 43 21 3 202 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q7VKK0 0.000749 43 23 5 206 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B4EUF0 0.000874 43 22 4 191 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Proteus mirabilis (strain HI4320)
Q7MNT0 0.001 42 24 5 202 3 mtnN 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Vibrio vulnificus (strain YJ016)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS15215
Feature type CDS
Gene deoD
Product purine-nucleoside phosphorylase
Location 23767 - 24486 (strand: 1)
Length 720 (nucleotides) / 239 (amino acids)

Contig

Accession term accessions NZ_VXKB01000005 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 213534 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_76
Orthogroup size 13
N. genomes 7

Actions

Genomic region

Domains

PF01048 Phosphorylase superfamily

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0813 Nucleotide transport and metabolism (F) F Purine-nucleoside phosphorylase

Kegg Ortholog Annotation(s)

Protein Sequence

MATPHINAELGDFADVVLMPGDPLRAKYIAENFLDDIKQVNDVRGMLGFTGTYKGRRISVMGHGMGIPSCSIYAKELITEFGVKTIIRVGSCGAISPDVKLRDVVIAMGASTDSKVNRLRFKDNDFAAIADFGLVRNAVDAAEKAGIPARVGNIFSADLFYTPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTGDNLPSDERQTSFNEMITIALESVLLGDKQ

Flanking regions ( +/- flanking 50bp)

GCAGCGGTTGCCTGCCCTTTCCCTTTGCGATTTACTGAAAGGAATTTCTTATGGCTACCCCTCACATTAATGCTGAATTGGGTGATTTTGCAGATGTTGTTCTGATGCCGGGCGATCCGCTGCGGGCGAAATATATCGCAGAAAACTTTTTAGACGACATTAAACAAGTTAATGATGTGCGTGGCATGCTGGGTTTCACCGGAACGTATAAAGGCCGCCGTATTTCAGTAATGGGTCACGGAATGGGGATCCCATCCTGCTCTATTTATGCAAAAGAGCTCATTACTGAATTTGGCGTAAAAACCATTATCCGTGTTGGTTCATGCGGGGCAATCAGCCCTGATGTTAAACTGCGCGATGTGGTTATTGCCATGGGCGCAAGTACGGATTCCAAGGTAAATCGCCTGCGTTTTAAAGATAATGACTTTGCCGCAATCGCCGATTTTGGTCTGGTGCGCAATGCGGTTGATGCAGCAGAAAAGGCGGGTATTCCTGCGCGTGTGGGGAATATTTTCTCTGCTGATTTATTCTATACGCCGGATCCGCAGATGTTTGATGTAATGGAAAAATACGGTATTTTAGGCGTGGAAATGGAAGCTGCCGGTATTTACGGTGTTGCCGCTGAGTTTGGTGCGAAAGCACTGACTATCTGCACTGTTTCTGACCATATCCGTACCGGTGATAATCTGCCTTCAGATGAGCGTCAGACTTCATTTAATGAAATGATTACGATTGCACTGGAATCAGTATTACTGGGCGATAAACAGTAATTTATTTTCGTCATCATAATAAAAACCTCTGCCGGTATTATTCCCCCGCA