Homologs in group_511

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00395 FBDBKF_00395 100.0 Morganella morganii S1 ubiG bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG
EHELCC_01150 EHELCC_01150 100.0 Morganella morganii S2 ubiG bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG
NLDBIP_02310 NLDBIP_02310 100.0 Morganella morganii S4 ubiG bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG
HKOGLL_03220 HKOGLL_03220 100.0 Morganella morganii S5 ubiG bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG
F4V73_RS06375 F4V73_RS06375 92.9 Morganella psychrotolerans ubiG bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG
PMI_RS08505 PMI_RS08505 74.7 Proteus mirabilis HI4320 - bifunctional 3-demethylubiquinone 3-O-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase

Distribution of the homologs in the orthogroup group_511

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_511

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N2M5 2.84e-140 395 77 0 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6TBT7 8.08e-140 394 77 0 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XNZ3 1.25e-139 394 77 0 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Klebsiella pneumoniae (strain 342)
B4EZ30 1.68e-139 394 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Proteus mirabilis (strain HI4320)
B7LM95 4.96e-139 392 76 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7MXR3 3.76e-138 390 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O81 (strain ED1a)
A4WCN5 4.37e-138 390 77 0 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Enterobacter sp. (strain 638)
Q1R9I4 4.95e-138 390 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain UTI89 / UPEC)
B7MFZ8 4.95e-138 390 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q0TFL0 5.06e-138 390 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B5YX17 1.64e-137 389 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XE29 1.64e-137 389 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O157:H7
A9MJY3 2.44e-137 388 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
C6DBN5 2.53e-137 388 79 0 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q32DV8 3.02e-137 388 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
B7N5J4 3.02e-137 388 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P17993 3.02e-137 388 75 0 238 1 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain K12)
B1X8C6 3.02e-137 388 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain K12 / DH10B)
C4ZU73 3.02e-137 388 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
A7ZP50 3.02e-137 388 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q31Z65 4.15e-137 387 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella boydii serotype 4 (strain Sb227)
B2TW20 4.15e-137 387 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I7I7 4.15e-137 387 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain SE11)
B7M5R7 4.15e-137 387 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O8 (strain IAI1)
B7LAP9 4.15e-137 387 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain 55989 / EAEC)
B7UFP4 4.74e-137 387 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q3YZX6 6.58e-137 387 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella sonnei (strain Ss046)
Q820C5 6.58e-137 387 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella flexneri
Q0T2P9 6.58e-137 387 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella flexneri serotype 5b (strain 8401)
B1IXV6 8.46e-137 387 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8FFP0 1.48e-136 386 75 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A296 1.76e-136 386 74 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O9:H4 (strain HS)
P37431 1.79e-136 386 74 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TPG0 1.79e-136 386 74 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella schwarzengrund (strain CVM19633)
B4SYU8 1.79e-136 386 74 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella newport (strain SL254)
B4TBE3 1.79e-136 386 74 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella heidelberg (strain SL476)
B5FNR7 1.79e-136 386 74 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella dublin (strain CT_02021853)
B5EYW1 1.79e-136 386 74 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella agona (strain SL483)
A8ADY5 2.66e-136 385 75 0 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A8GGX8 3.23e-136 385 76 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Serratia proteamaculans (strain 568)
C0Q093 5.54e-136 385 74 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella paratyphi C (strain RKS4594)
B5RCA1 5.54e-136 385 74 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R249 5.54e-136 385 74 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella enteritidis PT4 (strain P125109)
Q57M77 5.54e-136 385 74 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella choleraesuis (strain SC-B67)
Q6D7X5 5.97e-136 384 79 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8Z560 7.62e-136 384 74 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella typhi
B7NN47 1.92e-135 383 77 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B1LLI3 2.42e-135 383 77 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
A1JLA0 7.28e-135 382 76 1 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A7MPA9 2.36e-134 380 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
B5BCS0 8.3e-134 379 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella paratyphi A (strain AKU_12601)
Q5PCY1 8.3e-134 379 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B1JS96 9.89e-134 379 78 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CZ4 9.89e-134 379 78 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNI8 9.89e-134 379 78 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis (strain Pestoides F)
Q1CFZ1 9.89e-134 379 78 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R284 9.89e-134 379 78 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGR6 9.89e-134 379 78 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis
B2K9A4 9.89e-134 379 78 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C9H5 9.89e-134 379 78 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKF4 9.89e-134 379 78 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2VIL6 2.43e-133 378 76 0 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NSL7 1.12e-131 374 75 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Sodalis glossinidius (strain morsitans)
C3LLV3 8.82e-127 362 69 1 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KSJ9 8.82e-127 362 69 1 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F1U0 8.82e-127 362 69 1 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B5FDT8 5.12e-125 357 70 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aliivibrio fischeri (strain MJ11)
Q5E5J8 5.29e-125 357 70 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7MM27 1.62e-124 355 71 0 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio vulnificus (strain YJ016)
Q8D8E0 1.62e-124 355 71 0 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio vulnificus (strain CMCP6)
B7VGS0 9.07e-123 351 69 0 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio atlanticus (strain LGP32)
Q87ND5 5.38e-122 349 68 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MU79 3.27e-120 344 68 0 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio campbellii (strain ATCC BAA-1116)
Q6LPD7 8.94e-119 341 67 0 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Photobacterium profundum (strain SS9)
A9L2Y4 1.58e-108 315 63 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella baltica (strain OS195)
A6WNN7 1.58e-108 315 63 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella baltica (strain OS185)
A3D499 1.58e-108 315 63 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EA88 1.58e-108 315 63 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella baltica (strain OS223)
A4SM99 4.39e-108 314 65 0 226 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aeromonas salmonicida (strain A449)
A1RJD1 7.48e-108 313 62 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella sp. (strain W3-18-1)
A4Y759 1.17e-107 313 62 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B0V5X4 2.88e-107 312 64 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain AYE)
B7IBN2 2.88e-107 312 64 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain AB0057)
B7H2Y9 2.88e-107 312 64 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain AB307-0294)
B0VMN8 3.01e-107 311 64 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain SDF)
B2I023 4.36e-107 311 63 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain ACICU)
Q0HIX5 5.19e-107 311 63 0 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella sp. (strain MR-4)
Q8EEG9 8.4e-107 310 63 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A0KWN3 1.05e-106 310 63 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella sp. (strain ANA-3)
A8H499 1.73e-106 310 62 0 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q0HV07 2.13e-106 310 63 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella sp. (strain MR-7)
Q21IR9 2.99e-106 309 61 2 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q6FFY1 3.53e-106 309 62 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q4K8M4 1.12e-104 305 63 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1IDA6 9.28e-104 303 63 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas entomophila (strain L48)
B0TT38 1.86e-103 302 61 0 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella halifaxensis (strain HAW-EB4)
Q3ILA5 2.05e-103 302 60 0 226 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudoalteromonas translucida (strain TAC 125)
Q88M10 3.3e-103 301 62 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W7G3 3.3e-103 301 62 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q9HZ63 6.44e-103 300 63 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B1J5G4 7.03e-103 300 62 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain W619)
Q02PX7 7.42e-103 300 63 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q3K8T6 7.5e-103 300 62 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain Pf0-1)
B7V9J5 1.01e-102 300 63 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain LESB58)
B0KTX4 1.3e-102 300 62 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain GB-1)
C3K6J1 1.8e-102 300 62 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain SBW25)
A6V2Q4 2.19e-102 299 63 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain PA7)
Q885T9 2.27e-102 299 62 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZQ90 5.62e-102 298 62 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas syringae pv. syringae (strain B728a)
Q48FM4 5.62e-102 298 62 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A3MZ07 2.12e-101 297 58 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B3H0C8 9.58e-101 295 57 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A1S6C9 5.18e-100 293 60 0 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q9CMI6 2.66e-99 292 55 1 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pasteurella multocida (strain Pm70)
A4VLX7 6.88e-99 290 61 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Stutzerimonas stutzeri (strain A1501)
Q7VKW2 1.59e-97 287 57 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
C1DRQ3 2.8e-97 286 60 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B0UUV6 3.25e-97 286 57 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Histophilus somni (strain 2336)
Q2SE61 9.09e-97 285 60 1 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Hahella chejuensis (strain KCTC 2396)
A1U3K1 2.09e-96 284 57 2 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q0I3Y4 3.3e-96 284 57 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Histophilus somni (strain 129Pt)
Q3J8U2 6.64e-96 283 57 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q5P7U3 1.22e-95 282 55 1 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q482G8 2.24e-94 280 53 2 245 3 ubiG Ubiquinone biosynthesis O-methyltransferase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q2L2T5 5.22e-94 278 54 0 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella avium (strain 197N)
Q7WGT9 6.43e-94 278 55 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VZG7 1.78e-93 277 55 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q0AA73 5.04e-93 276 55 1 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q3SK91 9.29e-93 275 57 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Thiobacillus denitrificans (strain ATCC 25259)
Q7W5Z6 1.5e-92 275 55 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
B1Y2L3 2.9e-92 274 55 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A1TSA0 2.97e-92 274 56 2 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paracidovorax citrulli (strain AAC00-1)
A1K8Q1 5.34e-92 273 54 1 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Azoarcus sp. (strain BH72)
Q21UL3 1.42e-91 273 55 2 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q5QZ53 6.52e-90 268 52 0 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q2Y6Z3 7.41e-90 268 55 1 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q8Y0Z5 7.91e-90 268 56 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q81ZZ2 9.1e-90 267 54 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q47GP8 3.16e-89 266 52 1 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Dechloromonas aromatica (strain RCB)
B8F4B1 4.64e-89 266 51 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Glaesserella parasuis serovar 5 (strain SH0165)
Q4FVG3 1.91e-88 265 53 2 241 3 ubiG Ubiquinone biosynthesis O-methyltransferase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1QEI9 9.84e-88 263 53 2 241 3 ubiG Ubiquinone biosynthesis O-methyltransferase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q46Y42 2.9e-86 259 54 1 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B2JEZ6 2.98e-86 258 53 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q7NZ91 2.01e-85 256 54 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q13VB4 6.93e-84 252 53 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paraburkholderia xenovorans (strain LB400)
B2T641 2.18e-83 251 53 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q9JWE6 2.6e-83 251 56 3 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9JXI7 4.44e-83 250 56 3 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M0C4 6.65e-83 250 56 3 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Neisseria meningitidis serogroup C (strain 053442)
Q63RZ8 2.02e-82 249 52 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia pseudomallei (strain K96243)
Q3JPX1 2.02e-82 249 52 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia pseudomallei (strain 1710b)
Q62M18 2.02e-82 249 52 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia mallei (strain ATCC 23344)
A9ADW3 2.69e-82 248 53 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia multivorans (strain ATCC 17616 / 249)
Q2SY32 5.34e-82 248 52 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A4JCG7 6.22e-82 247 52 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q8PK00 7.75e-82 247 47 1 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas axonopodis pv. citri (strain 306)
Q0BHA0 1.46e-81 246 52 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YV26 1.46e-81 246 52 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia ambifaria (strain MC40-6)
Q609G2 1.66e-81 246 50 1 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q31GD8 1.85e-81 246 49 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q5GZB5 3.06e-81 246 47 1 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SHS9 3.06e-81 246 47 1 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P2C4 3.06e-81 246 47 1 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BSF8 3.31e-81 246 47 1 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B6J5Y2 3.42e-81 246 48 2 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain CbuK_Q154)
Q1BY35 9.12e-81 244 51 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia orbicola (strain AU 1054)
B1JXR2 9.12e-81 244 51 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia orbicola (strain MC0-3)
A0K5L4 9.12e-81 244 51 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia cenocepacia (strain HI2424)
Q39IG8 9.33e-81 244 51 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4EB49 9.64e-81 244 51 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q820B5 1.34e-80 244 49 2 224 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NBI0 1.34e-80 244 49 2 224 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J1W2 1.34e-80 244 49 2 224 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain CbuG_Q212)
A9KGL7 2.97e-80 243 48 2 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain Dugway 5J108-111)
Q8P8H2 2.96e-77 236 46 1 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RS27 2.96e-77 236 46 1 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas campestris pv. campestris (strain B100)
Q4UVL4 2.96e-77 236 46 1 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas campestris pv. campestris (strain 8004)
Q87BG5 1.76e-75 231 45 1 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I705 1.76e-75 231 45 1 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain M23)
B0U3W1 3.1e-75 231 45 1 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain M12)
Q9PAM5 3.24e-75 231 45 1 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain 9a5c)
B8H209 2.7e-67 211 42 1 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A9X1 2.7e-67 211 42 1 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q11E01 1.57e-66 209 43 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Chelativorans sp. (strain BNC1)
Q28VP7 2.4e-66 208 44 3 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Jannaschia sp. (strain CCS1)
A7HTX8 3.16e-65 206 41 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A4WW91 3.19e-65 205 44 3 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q5LWM6 3.55e-65 205 45 3 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q0AME1 3.79e-65 205 39 2 247 3 ubiG Ubiquinone biosynthesis O-methyltransferase Maricaulis maris (strain MCS10)
A1URT5 1.44e-64 204 40 2 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B0SW81 1.56e-64 204 41 1 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Caulobacter sp. (strain K31)
Q2W6W0 3.09e-64 203 43 2 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A8LQ43 3.68e-64 202 43 3 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q16D32 3.88e-64 202 44 3 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q3IYM5 4.73e-64 202 42 3 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
B9KPP7 7.97e-64 202 42 3 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A3PNM3 1.06e-63 201 42 3 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A9IQF4 1.5e-63 201 41 2 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q21BZ6 2.28e-63 201 40 2 245 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain BisB18)
Q8YJ98 5.81e-63 199 41 3 246 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RFB8 5.81e-63 199 41 3 246 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella melitensis biotype 2 (strain ATCC 23457)
Q8FYK0 6.69e-63 199 41 3 246 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella suis biovar 1 (strain 1330)
B0CIC6 6.69e-63 199 41 3 246 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VSK3 6.69e-63 199 41 3 246 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A9M8K8 6.69e-63 199 41 3 246 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q2YLN5 6.69e-63 199 41 3 246 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella abortus (strain 2308)
B2S828 6.69e-63 199 41 3 246 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella abortus (strain S19)
Q6G0I1 1.67e-62 198 39 3 246 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bartonella quintana (strain Toulouse)
Q1RJC7 4.22e-62 197 39 3 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia bellii (strain RML369-C)
A8GX11 4.22e-62 197 39 3 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia bellii (strain OSU 85-389)
Q1GCH8 6.02e-62 197 43 3 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Ruegeria sp. (strain TM1040)
Q4UME7 2.09e-61 196 38 2 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A6WXQ0 2.39e-61 196 40 3 246 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q6G5K3 2.91e-61 195 40 3 246 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A4YKT6 3e-61 196 39 2 245 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bradyrhizobium sp. (strain ORS 278)
Q98G87 3.56e-61 195 39 2 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q13EZ9 4.24e-61 195 39 2 245 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain BisB5)
Q2J419 6.91e-61 194 38 2 245 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain HaA2)
A8EY40 1.44e-60 193 38 2 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia canadensis (strain McKiel)
A8GPB1 1.64e-60 194 38 2 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia akari (strain Hartford)
B3QCF3 4.01e-60 192 40 2 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain TIE-1)
Q6NC69 4.01e-60 192 40 2 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q8UA66 7.1e-60 192 39 3 249 3 ubiG Ubiquinone biosynthesis O-methyltransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
B8IUB0 4.46e-59 190 39 3 246 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q68WB5 8.61e-59 189 37 2 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q07VB6 2.1e-58 188 39 2 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain BisA53)
Q92MK1 2.13e-58 188 41 3 246 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium meliloti (strain 1021)
A6UCF6 3.18e-58 187 41 3 246 3 ubiG Ubiquinone biosynthesis O-methyltransferase Sinorhizobium medicae (strain WSM419)
C3MHQ9 3.74e-58 187 40 3 246 3 ubiG Ubiquinone biosynthesis O-methyltransferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9ZCT9 9.21e-58 186 36 2 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia prowazekii (strain Madrid E)
B0UAV0 6.13e-57 184 39 3 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylobacterium sp. (strain 4-46)
Q4FNA2 1.9e-56 183 37 3 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pelagibacter ubique (strain HTCC1062)
B3PP83 1.96e-56 183 40 2 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium etli (strain CIAT 652)
B5ZRR7 3.09e-56 182 40 2 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
A8HVC4 3.11e-56 182 37 2 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q2K3S8 3.84e-56 182 40 2 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q3SVP3 5.16e-56 182 39 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q89XU2 7.9e-56 182 40 3 243 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q1MBA9 1.1e-55 181 40 2 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B9JB78 1.45e-54 178 40 2 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q92H07 3.82e-54 178 32 2 279 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
B8EI29 1.74e-53 176 38 3 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q2RWE9 4.28e-53 174 36 2 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
O49354 2.55e-52 175 37 3 234 1 COQ3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Arabidopsis thaliana
Q54XD0 2.93e-48 164 35 6 246 3 coq3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Dictyostelium discoideum
Q9NZJ6 2.26e-46 160 35 3 237 1 COQ3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Homo sapiens
O74421 4.58e-46 157 40 4 222 3 coq3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q63159 2.83e-45 157 33 3 241 2 Coq3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Rattus norvegicus
Q8BMS4 5.99e-45 157 34 3 239 1 Coq3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Mus musculus
Q3T131 1.01e-43 154 33 3 240 2 COQ3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Bos taurus
P27680 3.45e-35 130 32 7 243 1 COQ3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O93995 1.97e-34 128 30 5 248 3 COQ3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Candida albicans
L0E172 1.82e-08 57 35 3 110 3 phqN Methyltransferase phqN Penicillium fellutanum
P9WEU0 2.27e-08 57 30 2 113 1 iliD S-adenosyl-L-methionine-dependent Diels-Alderase iliD Hypocrea jecorina (strain QM6a)
B9L8G5 3.52e-08 56 25 7 172 3 cmoB tRNA U34 carboxymethyltransferase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
U2ZU49 5.3e-07 53 33 5 120 1 arsM Arsenite methyltransferase Pseudomonas alcaligenes (strain ATCC 14909 / DSM 50342 / JCM 20561 / NBRC 14159 / NCIMB 9945 / NCTC 10367 / 1577)
A1SE26 6.59e-07 52 24 4 175 3 menG Demethylmenaquinone methyltransferase Nocardioides sp. (strain ATCC BAA-499 / JS614)
P67064 6.99e-07 52 28 3 126 3 menG Demethylmenaquinone methyltransferase Tropheryma whipplei (strain Twist)
P67065 6.99e-07 52 28 3 126 3 menG Demethylmenaquinone methyltransferase Tropheryma whipplei (strain TW08/27)
Q9ZSK1 8.39e-07 52 31 5 131 1 VTE4 Tocopherol O-methyltransferase, chloroplastic Arabidopsis thaliana
A0A8X8M4W6 1.39e-06 52 33 4 106 2 TMT3 Gamma-tocopherol methyltransferase, chloroplastic Catharanthus roseus
A9WRT1 1.43e-06 51 27 6 165 3 menG Demethylmenaquinone methyltransferase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q6MHQ3 2.56e-06 50 36 4 111 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q31JJ8 3.16e-06 50 28 3 117 3 cmoB tRNA U34 carboxymethyltransferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q2SZE1 3.17e-06 50 30 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q5R0Q5 3.36e-06 50 27 4 139 3 cmoB tRNA U34 carboxymethyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
P08442 3.41e-06 50 25 3 138 4 syc1184_c Uncharacterized protein syc1184_c Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q478R6 3.53e-06 50 32 6 139 3 prmA Ribosomal protein L11 methyltransferase Dechloromonas aromatica (strain RCB)
G0FUS0 4.13e-06 50 32 2 103 1 RAM_03320 27-O-demethylrifamycin SV methyltransferase Amycolatopsis mediterranei (strain S699)
Q54I98 4.4e-06 50 25 5 151 1 smt1 Probable cycloartenol-C-24-methyltransferase 1 Dictyostelium discoideum
Q55423 4.52e-06 49 29 5 134 3 sll0829 Uncharacterized methyltransferase sll0829 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A3PSZ4 4.76e-06 49 31 3 108 3 Mjls_0208 Uncharacterized methyltransferase Mjls_0208 Mycobacterium sp. (strain JLS)
A7I1I7 6.09e-06 49 28 4 107 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
P54458 6.13e-06 49 27 2 111 3 yqeM Putative methyltransferase YqeM Bacillus subtilis (strain 168)
P74388 6.21e-06 49 35 4 108 1 sll0418 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
C5D4V7 6.8e-06 49 30 3 105 3 GWCH70_2453 Putative methyltransferase GWCH70_2453 Geobacillus sp. (strain WCH70)
A1U9D7 7.26e-06 49 31 3 108 3 Mkms_0228 Uncharacterized methyltransferase Mkms_0228 Mycobacterium sp. (strain KMS)
Q1BFJ5 7.26e-06 49 31 3 108 3 Mmcs_0218 Uncharacterized methyltransferase Mmcs_0218 Mycobacterium sp. (strain MCS)
A4JBD7 7.87e-06 49 30 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
A6Q7V3 8.82e-06 49 28 4 107 3 cmoB tRNA U34 carboxymethyltransferase Sulfurovum sp. (strain NBC37-1)
A7MXI3 1.02e-05 49 33 3 105 3 prmA Ribosomal protein L11 methyltransferase Vibrio campbellii (strain ATCC BAA-1116)
Q603L5 1.24e-05 48 25 5 192 3 cmoB tRNA U34 carboxymethyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q9C6B9 1.39e-05 49 29 3 112 1 NMT3 Phosphoethanolamine N-methyltransferase 3 Arabidopsis thaliana
C4LL93 1.44e-05 48 23 4 173 3 menG Demethylmenaquinone methyltransferase Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
C5D3E5 1.49e-05 48 33 4 122 3 menG Demethylmenaquinone methyltransferase Geobacillus sp. (strain WCH70)
C1DCV9 1.49e-05 48 32 6 123 3 prmA Ribosomal protein L11 methyltransferase Laribacter hongkongensis (strain HLHK9)
Q15NL3 1.74e-05 48 28 4 127 3 cmoB tRNA U34 carboxymethyltransferase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A6Q3V1 2.05e-05 48 24 3 106 3 cmoB tRNA U34 carboxymethyltransferase Nitratiruptor sp. (strain SB155-2)
Q91WU5 2.28e-05 48 28 5 115 1 As3mt Arsenite methyltransferase Mus musculus
Q39JS9 2.41e-05 48 29 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q63QN9 2.62e-05 47 31 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia pseudomallei (strain K96243)
A3NDQ7 2.67e-05 47 31 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia pseudomallei (strain 668)
Q3JNI0 2.67e-05 47 31 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia pseudomallei (strain 1710b)
A1V0M1 2.72e-05 47 31 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia mallei (strain SAVP1)
Q62GX2 2.72e-05 47 31 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia mallei (strain ATCC 23344)
A2S5P8 2.72e-05 47 31 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia mallei (strain NCTC 10229)
A3MRB1 2.72e-05 47 31 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia mallei (strain NCTC 10247)
A0A8X8M505 3.31e-05 47 25 4 136 1 PeNMT Perivine-Nbeta-methyltransferase Catharanthus roseus
C4R7Z3 3.36e-05 48 24 9 198 1 PAS_chr4_0465 Sphingolipid C9-methyltransferase Komagataella phaffii (strain GS115 / ATCC 20864)
Q05197 3.39e-05 47 31 2 101 4 pmtA Phosphatidylethanolamine N-methyltransferase Cereibacter sphaeroides
B3QLI9 4.01e-05 47 35 4 109 3 menG Demethylmenaquinone methyltransferase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
O31474 4.23e-05 47 28 0 95 1 ycgJ Uncharacterized methyltransferase YcgJ Bacillus subtilis (strain 168)
Q6G577 4.29e-05 47 33 3 105 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q9FR44 4.47e-05 47 28 3 112 1 NMT1 Phosphoethanolamine N-methyltransferase 1 Arabidopsis thaliana
Q8VHT6 4.63e-05 47 29 5 116 1 As3mt Arsenite methyltransferase Rattus norvegicus
A0QUV5 4.65e-05 47 32 3 116 1 MSMEG_2350 Probable S-adenosylmethionine-dependent methyltransferase MSMEG_2350/MSMEI_2290 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8CWG0 4.8e-05 47 33 5 115 3 menG Demethylmenaquinone methyltransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q7VGI1 4.92e-05 47 22 2 111 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A9AI41 5.14e-05 47 29 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia multivorans (strain ATCC 17616 / 249)
B7GHP8 5.19e-05 46 27 7 197 3 menG Demethylmenaquinone methyltransferase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A7Z627 6e-05 46 31 2 104 3 menG Demethylmenaquinone methyltransferase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q6G1I2 6.11e-05 46 32 2 99 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bartonella quintana (strain Toulouse)
B1JVC0 6.24e-05 46 29 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia orbicola (strain MC0-3)
Q13U36 6.29e-05 46 31 4 124 3 prmA Ribosomal protein L11 methyltransferase Paraburkholderia xenovorans (strain LB400)
Q6LLY5 6.42e-05 46 32 4 108 3 prmA Ribosomal protein L11 methyltransferase Photobacterium profundum (strain SS9)
I1RGC4 6.49e-05 47 27 3 122 2 FG02783.1 Sterol 24-C-methyltransferase ERG6A Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q6ZIK0 6.54e-05 47 34 7 113 2 VTE4 Probable tocopherol O-methyltransferase, chloroplastic Oryza sativa subsp. japonica
Q0BIF9 6.59e-05 46 29 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q5WGT4 6.61e-05 46 30 8 165 3 menG Demethylmenaquinone methyltransferase Shouchella clausii (strain KSM-K16)
E3G327 6.81e-05 46 28 3 114 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Enterobacter lignolyticus (strain SCF1)
B1YSW5 7.5e-05 46 29 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia ambifaria (strain MC40-6)
Q65I24 7.83e-05 46 33 3 106 3 menG Demethylmenaquinone methyltransferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P65347 7.99e-05 45 30 3 113 3 BQ2027_MB0092 Uncharacterized methyltransferase Mb0092 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WK03 7.99e-05 45 30 3 113 3 Rv0089 Uncharacterized methyltransferase Rv0089 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WK02 7.99e-05 45 30 3 113 3 MT0098 Uncharacterized methyltransferase MT0098 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9SW18 8.03e-05 46 28 3 121 1 CHLM Magnesium protoporphyrin IX methyltransferase, chloroplastic Arabidopsis thaliana
B4E5V2 8.22e-05 46 29 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q1BZC1 8.3e-05 46 29 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia orbicola (strain AU 1054)
A0K4C9 8.3e-05 46 29 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia cenocepacia (strain HI2424)
Q22993 8.79e-05 46 29 5 106 1 pmt-2 Phosphoethanolamine N-methyltransferase 2 Caenorhabditis elegans
Q8KF69 8.84e-05 46 33 4 109 3 menG Demethylmenaquinone methyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B4S0J9 8.95e-05 46 26 4 119 3 cmoB tRNA U34 carboxymethyltransferase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q21FY5 0.000102 46 25 2 123 3 bioC Biotin biosynthesis bifunctional protein BioHC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B2JH19 0.000104 46 31 4 124 3 prmA Ribosomal protein L11 methyltransferase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q17Y58 0.000107 45 28 2 106 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter acinonychis (strain Sheeba)
A6T2B6 0.000107 46 32 4 106 3 prmA Ribosomal protein L11 methyltransferase Janthinobacterium sp. (strain Marseille)
Q8CSH9 0.000109 45 28 7 169 3 menG Demethylmenaquinone methyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HP74 0.000109 45 28 7 169 3 menG Demethylmenaquinone methyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A8G0S7 0.000115 45 29 6 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sediminis (strain HAW-EB3)
A9ILA7 0.000116 45 33 3 100 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bartonella tribocorum (strain CIP 105476 / IBS 506)
A0A1U8QYZ5 0.00012 46 25 7 189 3 smtA Sphingolipid C9-methyltransferase A Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B8DBZ5 0.00012 45 33 6 124 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4a (strain HCC23)
Q9KCC4 0.000121 45 29 1 110 3 menG Demethylmenaquinone methyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A4G8P4 0.000126 45 33 3 106 3 prmA Ribosomal protein L11 methyltransferase Herminiimonas arsenicoxydans
A7GXW7 0.000128 45 28 4 106 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter curvus (strain 525.92)
Q67S51 0.00014 45 31 7 161 3 prmA Ribosomal protein L11 methyltransferase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
C8YTM5 0.000145 46 29 3 109 1 PEAMT2 Phosphoethanolamine N-methyltransferase Triticum aestivum
A7MTX1 0.000153 45 33 3 102 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio campbellii (strain ATCC BAA-1116)
Q6ZIX2 0.000156 45 29 6 150 2 Smt1-1 Cycloartenol-C-24-methyltransferase 1 Oryza sativa subsp. japonica
Q8KZ94 0.000156 45 28 5 151 1 rebM Demethylrebeccamycin-D-glucose O-methyltransferase Lentzea aerocolonigenes
D8MPW4 0.000159 45 31 3 109 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Erwinia billingiae (strain Eb661)
A5EVQ5 0.000169 45 27 5 159 3 cmoB tRNA U34 carboxymethyltransferase Dichelobacter nodosus (strain VCS1703A)
P67055 0.00017 45 30 6 132 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71Y84 0.00017 45 30 6 132 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4b (strain F2365)
C1KWN1 0.00017 45 30 6 132 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4b (strain CLIP80459)
P67056 0.00017 45 30 6 132 3 menG Demethylmenaquinone methyltransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8VYX1 0.000175 45 29 3 110 1 PEAMT1 Phosphoethanolamine N-methyltransferase 1 Triticum aestivum
A0AK43 0.000177 45 30 6 132 3 menG Demethylmenaquinone methyltransferase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
O86169 0.000179 45 31 2 113 3 menG Demethylmenaquinone methyltransferase Geobacillus stearothermophilus
Q4W9V1 0.000185 45 28 3 122 1 erg6 Sterol 24-C-methyltransferase erg6 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P0DO33 0.000188 45 29 2 110 1 iliD S-adenosyl-L-methionine-dependent Diels-Alderase iliD Neonectria sp. (strain DH2)
C0Z787 0.000193 45 25 2 107 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
C1DHS2 0.000213 45 28 6 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
P64842 0.000215 45 29 1 99 3 BQ2027_MB1440C Uncharacterized protein Mb1440c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WLY7 0.000215 45 29 1 99 1 Rv1405c Uncharacterized protein Rv1405c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WLY6 0.000215 45 29 1 99 3 MT1449 Uncharacterized protein MT1449 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9M571 0.000234 45 30 3 105 1 PEAMT Phosphoethanolamine N-methyltransferase Spinacia oleracea
Q21JL7 0.00026 45 26 7 166 3 cmoB tRNA U34 carboxymethyltransferase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q5KXU0 0.000262 44 30 2 113 3 menG Demethylmenaquinone methyltransferase Geobacillus kaustophilus (strain HTA426)
Q87TH4 0.000279 44 32 3 102 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P64920 0.000328 44 28 6 155 4 BQ2027_MB2026C Uncharacterized protein Mb2026c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WJZ5 0.000328 44 28 6 155 1 Rv2003c Uncharacterized protein Rv2003c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJZ4 0.000328 44 28 6 155 2 MT2059 Uncharacterized protein MT2059 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q6C2D9 0.000349 44 37 5 102 3 ERG6 Sterol 24-C-methyltransferase Yarrowia lipolytica (strain CLIB 122 / E 150)
D2T333 0.000369 44 31 2 103 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Erwinia pyrifoliae (strain DSM 12163 / CIP 106111 / Ep16/96)
A0A1D6NER6 0.000374 44 29 3 104 2 PEAMT1 Phosphoethanolamine N-methyltransferase 1 Zea mays
Q9K623 0.000402 44 24 3 107 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
I1RNL0 0.000418 44 24 8 191 3 MT2 Sphingolipid C9-methyltransferase 2 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
B1KR07 0.000424 43 28 6 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella woodyi (strain ATCC 51908 / MS32)
Q088H8 0.000428 43 29 7 156 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella frigidimarina (strain NCIMB 400)
P46326 0.000463 43 27 2 102 3 yxbB Uncharacterized protein YxbB Bacillus subtilis (strain 168)
Q0HZP7 0.000581 43 27 6 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain MR-7)
Q0HEA1 0.000581 43 27 6 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain MR-4)
A0L1M4 0.000581 43 27 6 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain ANA-3)
P31113 0.000585 43 26 5 157 1 menG Demethylmenaquinone methyltransferase Bacillus subtilis (strain 168)
A8FEK9 0.000599 43 29 3 122 3 menG Demethylmenaquinone methyltransferase Bacillus pumilus (strain SAFR-032)
Q5QYG2 0.00062 43 33 4 105 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q7MQ33 0.000654 43 31 3 102 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio vulnificus (strain YJ016)
Q8DDP9 0.000654 43 31 3 102 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio vulnificus (strain CMCP6)
H2E7T5 0.000727 43 30 4 106 1 TMT-1 Squalene methyltransferase 1 Botryococcus braunii
B5Z809 0.000747 43 27 2 106 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain G27)
H2E7T6 0.000812 43 31 3 100 1 TMT-2 Squalene methyltransferase 2 Botryococcus braunii
A1SAJ8 0.000818 43 29 4 107 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q88SI6 0.000866 43 28 2 101 3 menG Demethylmenaquinone methyltransferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q12S23 0.00088 43 29 4 107 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
C3LQP9 0.000893 43 30 4 108 3 prmA Ribosomal protein L11 methyltransferase Vibrio cholerae serotype O1 (strain M66-2)
A0A075D5I4 0.001 43 26 3 109 1 PiNMT Picrinine-N-methytransferase Rauvolfia serpentina
B2UUE3 0.001 43 27 2 106 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain Shi470)
A6VDI6 0.001 43 29 4 107 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain PA7)
Q9KV64 0.001 43 30 4 108 3 prmA Ribosomal protein L11 methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q6AIL0 0.001 43 24 7 170 3 cmoB tRNA U34 carboxymethyltransferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_03825
Feature type CDS
Gene ubiG
Product bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG
Location 35586 - 36311 (strand: 1)
Length 726 (nucleotides) / 241 (amino acids)
In genomic island -

Contig

Accession ZDB_361
Length 286024 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_511
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13489 Methyltransferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2227 Coenzyme transport and metabolism (H) H 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase

Kegg Ortholog Annotation(s)

Protein Sequence

MNDTASPLTANVDPAEIKKFEDVASRWWDLEGEFKPLHRINPLRLAYIQQRVNGVFGKKVLDVGCGGGILAESMAREGADVTGLDMGAEPLQVARLHALENGTDITYVQETVEQHAEKHAQQYDVVTCMEMLEHVPDPASVVRSCARLVKPGGDVVFSTINRNKKAWFMAVIAAEYILKMVPPGTHDAKKFIRPAELIDWLNNTGLREQHMIGLHYNPLSDKFWLAPNVDVNYMLHTRFIL

Flanking regions ( +/- flanking 50bp)

CCATCGCGTATTCCGGCAGGTTCTGCCGCAGCAAGAGAGAGAAAGAGACCATGAATGACACAGCTTCCCCGCTGACAGCCAATGTCGATCCTGCGGAAATCAAAAAGTTTGAGGATGTTGCCTCACGCTGGTGGGATCTTGAGGGTGAATTTAAACCGCTGCACCGGATCAATCCGCTGCGTCTGGCCTATATTCAGCAGCGGGTTAACGGTGTGTTCGGGAAGAAAGTGCTGGATGTCGGCTGCGGCGGCGGAATTCTGGCAGAAAGTATGGCGCGGGAAGGTGCGGACGTCACCGGGCTGGATATGGGCGCAGAGCCGCTTCAGGTTGCGCGTCTGCATGCACTGGAAAACGGCACTGATATCACCTATGTGCAGGAAACGGTGGAACAGCACGCAGAAAAACATGCACAACAGTATGATGTGGTGACCTGCATGGAGATGCTTGAGCATGTGCCGGATCCGGCGTCTGTGGTGCGTTCCTGTGCCCGTCTGGTCAAACCGGGGGGCGATGTGGTGTTCTCCACCATTAACCGCAACAAAAAAGCCTGGTTTATGGCGGTTATCGCAGCAGAATATATTCTGAAAATGGTACCGCCCGGTACGCACGATGCGAAAAAATTTATCCGTCCGGCAGAACTGATTGACTGGCTGAATAATACCGGTCTGCGTGAGCAGCATATGATCGGCTTACATTACAATCCGTTAAGCGATAAATTCTGGCTGGCACCCAATGTGGATGTAAATTATATGTTGCATACCCGTTTTATTTTATAGTGTCAAGTTAATTACTCCGGCGATTAATAAAACGCCAAACAAATCGCATT