Homologs in group_436

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00395 FBDBKF_00395 92.9 Morganella morganii S1 ubiG bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG
EHELCC_01150 EHELCC_01150 92.9 Morganella morganii S2 ubiG bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG
NLDBIP_02310 NLDBIP_02310 92.9 Morganella morganii S4 ubiG bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG
LHKJJB_03825 LHKJJB_03825 92.9 Morganella morganii S3 ubiG bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG
HKOGLL_03220 HKOGLL_03220 92.9 Morganella morganii S5 ubiG bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG
PMI_RS08505 PMI_RS08505 73.9 Proteus mirabilis HI4320 - bifunctional 3-demethylubiquinone 3-O-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase

Distribution of the homologs in the orthogroup group_436

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_436

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N2M5 1.09e-138 392 76 1 244 3 ubiG Ubiquinone biosynthesis O-methyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6TBT7 6.87e-137 387 76 0 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XNZ3 7.92e-137 387 76 0 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Klebsiella pneumoniae (strain 342)
B4EZ30 1.76e-136 386 73 1 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Proteus mirabilis (strain HI4320)
C6DBN5 2.06e-135 383 78 0 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A8GGX8 5.02e-134 380 76 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Serratia proteamaculans (strain 568)
B1JS96 1.04e-133 379 75 0 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CZ4 1.04e-133 379 75 0 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNI8 1.04e-133 379 75 0 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis (strain Pestoides F)
Q1CFZ1 1.04e-133 379 75 0 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R284 1.04e-133 379 75 0 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGR6 1.04e-133 379 75 0 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis
B2K9A4 1.04e-133 379 75 0 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C9H5 1.04e-133 379 75 0 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKF4 1.04e-133 379 75 0 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4WCN5 2.12e-133 378 75 0 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Enterobacter sp. (strain 638)
A1JLA0 4.51e-133 377 77 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B7LM95 6.65e-133 377 73 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q6D7X5 8.04e-133 377 78 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B7UFP4 8.56e-133 377 73 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A9MJY3 1.28e-132 376 73 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q32DV8 1.8e-132 376 73 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
B7N5J4 1.8e-132 376 73 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P17993 1.8e-132 376 73 0 235 1 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain K12)
B1X8C6 1.8e-132 376 73 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain K12 / DH10B)
C4ZU73 1.8e-132 376 73 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
A7ZP50 1.8e-132 376 73 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
A7MPA9 2.52e-132 375 75 0 232 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
Q31Z65 2.99e-132 375 73 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella boydii serotype 4 (strain Sb227)
B2TW20 2.99e-132 375 73 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I7I7 2.99e-132 375 73 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain SE11)
B7M5R7 2.99e-132 375 73 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O8 (strain IAI1)
B7LAP9 2.99e-132 375 73 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain 55989 / EAEC)
B7MXR3 3.76e-132 375 72 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O81 (strain ED1a)
Q1R9I4 5e-132 375 72 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain UTI89 / UPEC)
B7MFZ8 5e-132 375 72 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q0TFL0 5.28e-132 375 72 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q3YZX6 6.36e-132 374 73 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella sonnei (strain Ss046)
Q820C5 6.36e-132 374 73 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella flexneri
Q0T2P9 6.36e-132 374 73 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella flexneri serotype 5b (strain 8401)
B1IXV6 7.49e-132 374 73 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P37431 7.7e-132 374 72 1 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TPG0 7.7e-132 374 72 1 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella schwarzengrund (strain CVM19633)
B4SYU8 7.7e-132 374 72 1 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella newport (strain SL254)
B4TBE3 7.7e-132 374 72 1 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella heidelberg (strain SL476)
B5FNR7 7.7e-132 374 72 1 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella dublin (strain CT_02021853)
B5EYW1 7.7e-132 374 72 1 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella agona (strain SL483)
A8A296 1.02e-131 374 72 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O9:H4 (strain HS)
B5YX17 1.41e-131 374 72 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XE29 1.41e-131 374 72 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O157:H7
C0Q093 2.9e-131 373 71 1 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella paratyphi C (strain RKS4594)
B5RCA1 2.9e-131 373 71 1 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R249 2.9e-131 373 71 1 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella enteritidis PT4 (strain P125109)
Q57M77 2.9e-131 373 71 1 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella choleraesuis (strain SC-B67)
Q8Z560 3.69e-131 373 71 1 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella typhi
B2VIL6 6.83e-131 372 75 0 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NSL7 9.63e-131 372 75 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Sodalis glossinidius (strain morsitans)
B7NN47 1.22e-130 371 74 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B1LLI3 1.46e-130 371 74 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
Q8FFP0 1.65e-130 371 72 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8ADY5 3.93e-130 370 73 0 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5BCS0 2.37e-129 368 71 1 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella paratyphi A (strain AKU_12601)
Q5PCY1 2.37e-129 368 71 1 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
C3LLV3 2.17e-125 358 69 1 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KSJ9 2.17e-125 358 69 1 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F1U0 2.17e-125 358 69 1 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B7VGS0 6.57e-124 354 70 0 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio atlanticus (strain LGP32)
Q7MM27 2.11e-122 350 69 0 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio vulnificus (strain YJ016)
Q8D8E0 2.11e-122 350 69 0 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio vulnificus (strain CMCP6)
B5FDT8 2.32e-122 350 68 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aliivibrio fischeri (strain MJ11)
Q5E5J8 2.56e-122 350 68 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q87ND5 9.39e-120 343 67 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MU79 4.65e-119 342 67 0 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio campbellii (strain ATCC BAA-1116)
Q6LPD7 1.46e-116 335 66 0 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Photobacterium profundum (strain SS9)
A4SM99 6.37e-108 313 65 0 226 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aeromonas salmonicida (strain A449)
Q4K8M4 2.59e-107 312 64 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A9L2Y4 4.81e-107 311 63 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella baltica (strain OS195)
A6WNN7 4.81e-107 311 63 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella baltica (strain OS185)
A3D499 4.81e-107 311 63 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EA88 4.81e-107 311 63 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella baltica (strain OS223)
A0KWN3 9.07e-107 311 63 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella sp. (strain ANA-3)
Q0HIX5 1.18e-106 310 63 0 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella sp. (strain MR-4)
Q21IR9 1.37e-106 310 61 2 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q1IDA6 1.41e-106 310 64 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas entomophila (strain L48)
A6V2Q4 1.68e-106 310 65 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain PA7)
Q0HV07 2.11e-106 310 63 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella sp. (strain MR-7)
A1RJD1 3.6e-106 309 62 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella sp. (strain W3-18-1)
A4Y759 3.93e-106 309 62 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q88M10 6.75e-106 308 64 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W7G3 6.75e-106 308 64 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q8EEG9 7.75e-106 308 63 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q3K8T6 1.03e-105 308 64 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain Pf0-1)
B1J5G4 1.39e-105 307 64 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain W619)
Q9HZ63 2.22e-105 307 64 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B0KTX4 2.4e-105 307 63 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain GB-1)
Q885T9 2.77e-105 306 64 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
C3K6J1 3.3e-105 306 64 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain SBW25)
B7V9J5 3.45e-105 306 64 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain LESB58)
Q02PX7 6.72e-105 306 64 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q4ZQ90 1.27e-104 305 63 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas syringae pv. syringae (strain B728a)
Q48FM4 1.27e-104 305 63 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A8H499 1.33e-104 305 62 0 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q3ILA5 3.51e-103 301 61 0 226 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudoalteromonas translucida (strain TAC 125)
Q6FFY1 5.95e-103 301 61 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B0V5X4 7.56e-103 301 61 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain AYE)
B7IBN2 7.56e-103 301 61 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain AB0057)
B7H2Y9 7.56e-103 301 61 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain AB307-0294)
B0VMN8 9.1e-103 300 61 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain SDF)
B2I023 1.49e-102 300 60 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain ACICU)
B0TT38 9.24e-102 298 61 0 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella halifaxensis (strain HAW-EB4)
C1DRQ3 1.78e-100 295 62 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A4VLX7 1.3e-99 292 62 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Stutzerimonas stutzeri (strain A1501)
Q9CMI6 2.07e-99 292 56 1 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pasteurella multocida (strain Pm70)
A1S6C9 4.51e-99 291 60 0 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B0UUV6 1.46e-97 287 57 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Histophilus somni (strain 2336)
A3MZ07 2.84e-97 286 56 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B3H0C8 3.1e-97 286 56 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q2SE61 1.69e-96 285 60 1 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Hahella chejuensis (strain KCTC 2396)
Q0I3Y4 1.75e-96 285 57 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Histophilus somni (strain 129Pt)
Q7WGT9 6.37e-96 283 55 0 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VZG7 2.03e-95 282 54 0 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7VKW2 3.45e-95 281 56 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A1U3K1 4.64e-95 281 58 3 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q5P7U3 8.35e-95 280 55 1 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q7W5Z6 1.3e-94 280 54 0 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q2Y6Z3 2.17e-94 279 57 1 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q3J8U2 4.41e-94 278 57 1 226 3 ubiG Ubiquinone biosynthesis O-methyltransferase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q482G8 1.1e-93 278 55 1 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q5QZ53 2.81e-93 277 53 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q81ZZ2 3.55e-93 276 56 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1TSA0 6.64e-93 276 55 2 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paracidovorax citrulli (strain AAC00-1)
Q3SK91 1.39e-92 275 56 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Thiobacillus denitrificans (strain ATCC 25259)
B1Y2L3 3.76e-92 273 55 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A1K8Q1 1.73e-91 272 53 1 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Azoarcus sp. (strain BH72)
Q47GP8 2.51e-91 271 54 1 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Dechloromonas aromatica (strain RCB)
Q21UL3 3.86e-91 271 54 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q0AA73 5.45e-91 271 53 0 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q8Y0Z5 1.23e-90 270 57 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2L2T5 1.81e-90 270 52 1 241 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella avium (strain 197N)
Q46Y42 3.28e-88 264 55 1 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B8F4B1 3.97e-88 263 50 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Glaesserella parasuis serovar 5 (strain SH0165)
Q7NZ91 3.13e-87 261 54 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q4FVG3 5.27e-87 261 52 2 241 3 ubiG Ubiquinone biosynthesis O-methyltransferase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q13VB4 6.15e-87 260 55 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paraburkholderia xenovorans (strain LB400)
B2JEZ6 9.02e-87 260 54 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q1QEI9 2.13e-86 260 52 2 241 3 ubiG Ubiquinone biosynthesis O-methyltransferase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
B2T641 5.13e-85 255 55 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q9JWE6 1.56e-84 254 56 3 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q63RZ8 2.24e-84 254 53 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia pseudomallei (strain K96243)
Q3JPX1 2.24e-84 254 53 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia pseudomallei (strain 1710b)
Q62M18 2.24e-84 254 53 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia mallei (strain ATCC 23344)
Q9JXI7 2.61e-84 254 56 3 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q2SY32 3.39e-84 253 53 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q0BHA0 4.41e-84 253 53 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YV26 4.41e-84 253 53 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia ambifaria (strain MC40-6)
A9M0C4 4.51e-84 253 56 3 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Neisseria meningitidis serogroup C (strain 053442)
A4JCG7 1.33e-83 252 53 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
A9ADW3 4.56e-83 250 53 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia multivorans (strain ATCC 17616 / 249)
Q1BY35 5.86e-83 250 53 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia orbicola (strain AU 1054)
B1JXR2 5.86e-83 250 53 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia orbicola (strain MC0-3)
A0K5L4 5.86e-83 250 53 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia cenocepacia (strain HI2424)
Q39IG8 6.6e-83 250 53 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4EB49 7.13e-83 250 53 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q3BSF8 2.22e-82 249 48 2 241 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q31GD8 3.71e-82 248 50 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B6J5Y2 8.4e-82 247 48 2 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain CbuK_Q154)
Q820B5 2.95e-81 246 49 2 224 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NBI0 2.95e-81 246 49 2 224 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J1W2 2.95e-81 246 49 2 224 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain CbuG_Q212)
A9KGL7 7.29e-81 245 48 2 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain Dugway 5J108-111)
Q8PK00 8.31e-81 245 48 2 241 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas axonopodis pv. citri (strain 306)
Q5GZB5 9.27e-81 245 47 2 241 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SHS9 9.27e-81 245 47 2 241 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P2C4 9.27e-81 245 47 2 241 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q609G2 1.93e-80 244 49 1 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8P8H2 6.9e-80 243 48 1 232 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RS27 6.9e-80 243 48 1 232 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas campestris pv. campestris (strain B100)
Q4UVL4 6.9e-80 243 48 1 232 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas campestris pv. campestris (strain 8004)
Q87BG5 6.56e-77 235 47 1 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I705 6.56e-77 235 47 1 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain M23)
B0U3W1 9.93e-77 235 46 1 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain M12)
Q9PAM5 1.71e-76 234 47 1 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain 9a5c)
B8H209 9.76e-67 209 41 1 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A9X1 9.76e-67 209 41 1 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q11E01 6.18e-66 207 42 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Chelativorans sp. (strain BNC1)
A7HTX8 2.54e-65 206 42 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q0AME1 4.09e-64 203 39 2 246 3 ubiG Ubiquinone biosynthesis O-methyltransferase Maricaulis maris (strain MCS10)
Q2W6W0 5.14e-64 202 42 2 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q28VP7 1.87e-63 201 42 3 247 3 ubiG Ubiquinone biosynthesis O-methyltransferase Jannaschia sp. (strain CCS1)
A4WW91 2.05e-63 201 44 3 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q5LWM6 2.86e-63 201 45 3 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A8LQ43 2.86e-63 201 43 3 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A1URT5 3.16e-63 201 39 2 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B0SW81 5.11e-63 200 40 1 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Caulobacter sp. (strain K31)
Q3IYM5 8.6e-63 199 43 3 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
B9KPP7 1.27e-62 199 43 3 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A3PNM3 2.05e-62 198 42 3 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q8YJ98 3.19e-62 198 41 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RFB8 3.19e-62 198 41 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella melitensis biotype 2 (strain ATCC 23457)
Q8FYK0 3.92e-62 197 41 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella suis biovar 1 (strain 1330)
B0CIC6 3.92e-62 197 41 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VSK3 3.92e-62 197 41 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A9M8K8 3.92e-62 197 41 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q2YLN5 3.92e-62 197 41 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella abortus (strain 2308)
B2S828 3.92e-62 197 41 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella abortus (strain S19)
Q21BZ6 1.04e-61 197 41 2 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain BisB18)
A9IQF4 3.2e-61 195 40 2 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q16D32 3.56e-61 195 43 3 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q6G0I1 4.78e-61 195 39 2 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bartonella quintana (strain Toulouse)
Q1GCH8 9.68e-61 194 44 3 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Ruegeria sp. (strain TM1040)
Q4UME7 1.32e-60 194 39 2 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q1RJC7 4.35e-60 192 38 3 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia bellii (strain RML369-C)
A8GX11 4.35e-60 192 38 3 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia bellii (strain OSU 85-389)
A6WXQ0 4.37e-60 192 40 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q2J419 4.7e-60 192 39 2 243 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain HaA2)
Q98G87 8.26e-60 192 38 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A4YKT6 3.46e-59 190 38 3 250 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bradyrhizobium sp. (strain ORS 278)
A8GPB1 4.09e-59 190 38 2 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia akari (strain Hartford)
Q13EZ9 5.34e-59 190 39 2 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain BisB5)
B3QCF3 5.7e-59 190 39 2 243 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain TIE-1)
Q6NC69 5.7e-59 190 39 2 243 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q6G5K3 6.96e-59 189 39 2 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q8UA66 7.29e-59 189 39 2 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
A8EY40 1.34e-58 188 38 2 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia canadensis (strain McKiel)
B8IUB0 1.86e-58 188 38 3 250 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q68WB5 3.58e-57 185 37 2 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
B0UAV0 6.65e-57 184 39 3 241 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylobacterium sp. (strain 4-46)
Q07VB6 7.66e-57 184 38 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain BisA53)
Q9ZCT9 2.67e-56 183 36 2 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia prowazekii (strain Madrid E)
A8HVC4 3.72e-56 182 37 2 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q92MK1 4.3e-56 182 41 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium meliloti (strain 1021)
Q2K3S8 5.29e-56 182 40 2 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q89XU2 1.06e-55 181 39 3 249 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
C3MHQ9 1.56e-55 181 39 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B5ZRR7 2.46e-55 181 40 2 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q3SVP3 6.06e-55 180 38 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B3PP83 7.12e-55 179 40 2 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium etli (strain CIAT 652)
A6UCF6 8.74e-55 179 41 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Sinorhizobium medicae (strain WSM419)
Q1MBA9 2.01e-54 178 40 2 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q4FNA2 8.99e-54 176 35 3 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pelagibacter ubique (strain HTCC1062)
B9JB78 2.51e-53 175 40 2 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q92H07 6.41e-53 176 32 2 279 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q2RWE9 1.23e-52 173 36 2 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B8EI29 4.57e-52 172 36 3 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
O49354 2.45e-51 172 37 3 234 1 COQ3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Arabidopsis thaliana
Q54XD0 1.01e-46 160 35 4 244 3 coq3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Dictyostelium discoideum
O74421 6.19e-46 157 39 3 221 3 coq3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9NZJ6 6.74e-45 157 32 3 237 1 COQ3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Homo sapiens
Q3T131 6.76e-44 154 33 4 249 2 COQ3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Bos taurus
Q8BMS4 8.18e-44 154 33 3 239 1 Coq3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Mus musculus
Q63159 8.59e-44 154 32 3 241 2 Coq3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Rattus norvegicus
P27680 1.67e-35 131 31 6 251 1 COQ3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O93995 6.9e-34 127 31 5 245 3 COQ3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Candida albicans
G0FUS0 2.91e-08 56 26 4 178 1 RAM_03320 27-O-demethylrifamycin SV methyltransferase Amycolatopsis mediterranei (strain S699)
P9WEU0 6.47e-08 55 27 5 147 1 iliD S-adenosyl-L-methionine-dependent Diels-Alderase iliD Hypocrea jecorina (strain QM6a)
Q8CWG0 8.32e-08 55 32 7 145 3 menG Demethylmenaquinone methyltransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P74388 1.21e-07 55 37 4 108 1 sll0418 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B9L8G5 1.67e-07 54 25 7 171 3 cmoB tRNA U34 carboxymethyltransferase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
P08442 1.91e-07 54 30 3 120 4 syc1184_c Uncharacterized protein syc1184_c Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
L0E172 3.8e-07 53 34 3 110 3 phqN Methyltransferase phqN Penicillium fellutanum
Q9SW18 5.18e-07 53 31 3 121 1 CHLM Magnesium protoporphyrin IX methyltransferase, chloroplastic Arabidopsis thaliana
P67064 7.59e-07 52 29 4 127 3 menG Demethylmenaquinone methyltransferase Tropheryma whipplei (strain Twist)
P67065 7.59e-07 52 29 4 127 3 menG Demethylmenaquinone methyltransferase Tropheryma whipplei (strain TW08/27)
U2ZU49 1.39e-06 52 31 5 120 1 arsM Arsenite methyltransferase Pseudomonas alcaligenes (strain ATCC 14909 / DSM 50342 / JCM 20561 / NBRC 14159 / NCIMB 9945 / NCTC 10367 / 1577)
Q17Y58 1.7e-06 51 30 2 106 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter acinonychis (strain Sheeba)
A0A8X8M4W6 1.74e-06 51 33 4 106 2 TMT3 Gamma-tocopherol methyltransferase, chloroplastic Catharanthus roseus
Q9C6B9 2.08e-06 51 29 3 112 1 NMT3 Phosphoethanolamine N-methyltransferase 3 Arabidopsis thaliana
Q65I24 2.14e-06 50 36 4 106 3 menG Demethylmenaquinone methyltransferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q9ZSK1 5.19e-06 50 29 5 131 1 VTE4 Tocopherol O-methyltransferase, chloroplastic Arabidopsis thaliana
Q6MHQ3 5.75e-06 49 36 5 112 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
C8YTM5 6.4e-06 50 29 3 109 1 PEAMT2 Phosphoethanolamine N-methyltransferase Triticum aestivum
Q9FR44 7.54e-06 50 28 3 112 1 NMT1 Phosphoethanolamine N-methyltransferase 1 Arabidopsis thaliana
A3PSZ4 8.16e-06 49 32 3 108 3 Mjls_0208 Uncharacterized methyltransferase Mjls_0208 Mycobacterium sp. (strain JLS)
A0A1D6NER6 8.32e-06 49 29 3 104 2 PEAMT1 Phosphoethanolamine N-methyltransferase 1 Zea mays
A6Q7V3 8.64e-06 49 27 2 105 3 cmoB tRNA U34 carboxymethyltransferase Sulfurovum sp. (strain NBC37-1)
B8DBZ5 1.03e-05 48 35 5 106 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4a (strain HCC23)
A8G0S7 1.14e-05 48 29 6 152 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sediminis (strain HAW-EB3)
C5D4V7 1.26e-05 48 30 4 105 3 GWCH70_2453 Putative methyltransferase GWCH70_2453 Geobacillus sp. (strain WCH70)
A0AK43 1.31e-05 48 35 5 106 3 menG Demethylmenaquinone methyltransferase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A0A8X8M505 1.33e-05 48 27 4 136 1 PeNMT Perivine-Nbeta-methyltransferase Catharanthus roseus
A1U9D7 1.38e-05 48 32 3 108 3 Mkms_0228 Uncharacterized methyltransferase Mkms_0228 Mycobacterium sp. (strain KMS)
Q1BFJ5 1.38e-05 48 32 3 108 3 Mmcs_0218 Uncharacterized methyltransferase Mmcs_0218 Mycobacterium sp. (strain MCS)
P67055 1.48e-05 48 35 5 106 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71Y84 1.48e-05 48 35 5 106 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4b (strain F2365)
C1KWN1 1.48e-05 48 35 5 106 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4b (strain CLIP80459)
P67056 1.48e-05 48 35 5 106 3 menG Demethylmenaquinone methyltransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B2UUE3 1.48e-05 48 29 2 106 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain Shi470)
Q31JJ8 1.54e-05 48 29 3 117 3 cmoB tRNA U34 carboxymethyltransferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q05197 1.74e-05 47 32 2 101 4 pmtA Phosphatidylethanolamine N-methyltransferase Cereibacter sphaeroides
Q5WGT4 1.76e-05 48 29 8 161 3 menG Demethylmenaquinone methyltransferase Shouchella clausii (strain KSM-K16)
Q9ZKH1 1.84e-05 48 28 2 106 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain J99 / ATCC 700824)
A7I1I7 1.9e-05 48 29 4 107 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
P54458 1.93e-05 48 29 2 110 3 yqeM Putative methyltransferase YqeM Bacillus subtilis (strain 168)
Q1CSN0 2.07e-05 48 29 2 106 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain HPAG1)
O25173 2.15e-05 48 29 2 106 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain ATCC 700392 / 26695)
Q55423 2.17e-05 47 33 5 111 3 sll0829 Uncharacterized methyltransferase sll0829 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A0A1U8QYZ5 2.22e-05 48 25 7 189 3 smtA Sphingolipid C9-methyltransferase A Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
E3H9W1 2.24e-05 48 23 5 146 3 bioC1 Malonyl-[acyl-carrier protein] O-methyltransferase 1 Ilyobacter polytropus (strain ATCC 51220 / DSM 2926 / LMG 16218 / CuHBu1)
Q088H8 2.29e-05 47 29 8 156 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella frigidimarina (strain NCIMB 400)
A1SE26 2.42e-05 47 24 4 175 3 menG Demethylmenaquinone methyltransferase Nocardioides sp. (strain ATCC BAA-499 / JS614)
B1KR07 2.92e-05 47 28 6 152 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella woodyi (strain ATCC 51908 / MS32)
Q6ZIK0 3.6e-05 47 34 6 111 2 VTE4 Probable tocopherol O-methyltransferase, chloroplastic Oryza sativa subsp. japonica
Q6N3Y0 4.42e-05 47 28 6 163 1 arsM Arsenite methyltransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A7GXW7 4.43e-05 47 26 2 105 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter curvus (strain 525.92)
Q5R0Q5 4.47e-05 47 28 4 119 3 cmoB tRNA U34 carboxymethyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
P65347 4.59e-05 46 29 3 115 3 BQ2027_MB0092 Uncharacterized methyltransferase Mb0092 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WK03 4.59e-05 46 29 3 115 3 Rv0089 Uncharacterized methyltransferase Rv0089 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WK02 4.59e-05 46 29 3 115 3 MT0098 Uncharacterized methyltransferase MT0098 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
B6JMM9 4.75e-05 47 28 2 106 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain P12)
P46326 4.83e-05 47 30 5 129 3 yxbB Uncharacterized protein YxbB Bacillus subtilis (strain 168)
Q478R6 5.01e-05 47 31 5 137 3 prmA Ribosomal protein L11 methyltransferase Dechloromonas aromatica (strain RCB)
Q8CSH9 5.32e-05 46 27 7 170 3 menG Demethylmenaquinone methyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HP74 5.32e-05 46 27 7 170 3 menG Demethylmenaquinone methyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q2NYW4 5.51e-05 46 30 7 152 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A1SAJ8 5.66e-05 46 30 5 107 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q6AIL0 6.18e-05 47 24 7 170 3 cmoB tRNA U34 carboxymethyltransferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
C1DHS2 7.01e-05 46 28 6 155 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q944H0 7.14e-05 47 28 3 109 1 NMT2 Phosphoethanolamine N-methyltransferase 2 Arabidopsis thaliana
A7Z627 7.17e-05 46 34 5 108 3 menG Demethylmenaquinone methyltransferase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A6Q3V1 7.51e-05 46 25 3 106 3 cmoB tRNA U34 carboxymethyltransferase Nitratiruptor sp. (strain SB155-2)
P44074 7.52e-05 46 25 4 143 4 HI_0912 Uncharacterized protein HI_0912 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q91WU5 7.79e-05 46 29 5 114 1 As3mt Arsenite methyltransferase Mus musculus
Q7MQ33 7.87e-05 46 32 4 105 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio vulnificus (strain YJ016)
Q8DDP9 7.87e-05 46 32 4 105 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio vulnificus (strain CMCP6)
A6VDI6 8.1e-05 46 32 5 109 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain PA7)
B8E6B6 8.29e-05 46 27 7 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS223)
Q12S23 8.44e-05 46 30 4 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B8CI06 8.76e-05 46 28 6 152 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella piezotolerans (strain WP3 / JCM 13877)
Q8VHT6 8.77e-05 46 31 5 115 1 As3mt Arsenite methyltransferase Rattus norvegicus
Q8E9R7 9.26e-05 46 27 7 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9HUC0 9.31e-05 46 32 5 109 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02EV4 9.31e-05 46 32 5 109 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V3F6 9.31e-05 46 32 5 109 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain LESB58)
A9KYL8 9.35e-05 46 27 7 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS195)
A6WIE9 9.35e-05 46 27 7 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS185)
A3D9F2 9.35e-05 46 27 7 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS155 / ATCC BAA-1091)
A1RP78 9.61e-05 46 27 7 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain W3-18-1)
A4Y2Q5 9.61e-05 46 27 7 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A3NDQ7 9.84e-05 46 30 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia pseudomallei (strain 668)
Q3JNI0 9.84e-05 46 30 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia pseudomallei (strain 1710b)
Q0HZP7 9.89e-05 45 28 7 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain MR-7)
Q0HEA1 9.89e-05 45 28 7 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain MR-4)
A0L1M4 9.89e-05 45 28 7 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain ANA-3)
A1V0M1 9.93e-05 46 30 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia mallei (strain SAVP1)
Q62GX2 9.93e-05 46 30 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia mallei (strain ATCC 23344)
A2S5P8 9.93e-05 46 30 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia mallei (strain NCTC 10229)
A3MRB1 9.93e-05 46 30 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia mallei (strain NCTC 10247)
Q63QN9 0.000101 46 30 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia pseudomallei (strain K96243)
A9WRT1 0.000104 45 29 4 133 3 menG Demethylmenaquinone methyltransferase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
B0TJ16 0.000105 45 31 4 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella halifaxensis (strain HAW-EB4)
A0QUV5 0.000119 45 29 3 117 1 MSMEG_2350 Probable S-adenosylmethionine-dependent methyltransferase MSMEG_2350/MSMEI_2290 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q22993 0.00012 46 29 5 106 1 pmt-2 Phosphoethanolamine N-methyltransferase 2 Caenorhabditis elegans
Q54I98 0.000127 46 24 5 151 1 smt1 Probable cycloartenol-C-24-methyltransferase 1 Dictyostelium discoideum
A8H966 0.000133 45 28 6 152 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A0A075D5I4 0.000139 45 29 3 109 1 PiNMT Picrinine-N-methytransferase Rauvolfia serpentina
A7MTX1 0.000144 45 31 5 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio campbellii (strain ATCC BAA-1116)
C3K8U4 0.000148 45 28 6 153 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas fluorescens (strain SBW25)
Q9M571 0.000154 45 28 3 104 1 PEAMT Phosphoethanolamine N-methyltransferase Spinacia oleracea
Q87TH4 0.000157 45 30 5 109 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C3LPS5 0.000158 45 31 4 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain M66-2)
Q9KVQ6 0.000158 45 31 4 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4E5 0.000158 45 31 4 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A3QIE1 0.000166 45 28 6 152 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella loihica (strain ATCC BAA-1088 / PV-4)
C4LL93 0.000199 45 23 3 138 3 menG Demethylmenaquinone methyltransferase Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
Q8P558 0.000212 45 31 4 119 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9KCC4 0.000219 45 28 1 110 3 menG Demethylmenaquinone methyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7VGI1 0.000233 45 21 2 111 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
H2E7T6 0.00024 45 31 3 100 1 TMT-2 Squalene methyltransferase 2 Botryococcus braunii
B5Z809 0.000242 45 28 2 106 3 cmoB tRNA U34 carboxymethyltransferase Helicobacter pylori (strain G27)
O86169 0.000259 44 31 4 116 3 menG Demethylmenaquinone methyltransferase Geobacillus stearothermophilus
Q8VYX1 0.000278 45 27 3 109 1 PEAMT1 Phosphoethanolamine N-methyltransferase 1 Triticum aestivum
B4S0J9 0.000285 45 26 4 119 3 cmoB tRNA U34 carboxymethyltransferase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q8PPP2 0.000309 44 31 5 119 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xanthomonas axonopodis pv. citri (strain 306)
P49016 0.000319 44 32 5 115 3 menG Demethylmenaquinone methyltransferase Lactococcus lactis subsp. lactis (strain IL1403)
Q9LM02 0.000345 44 33 4 100 1 SMT1 Cycloartenol-C-24-methyltransferase Arabidopsis thaliana
C5D3E5 0.000346 44 33 4 114 3 menG Demethylmenaquinone methyltransferase Geobacillus sp. (strain WCH70)
C0Z787 0.000369 44 21 3 146 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q2SZE1 0.000376 44 28 6 142 3 prmA Ribosomal protein L11 methyltransferase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q6ZIX2 0.00044 44 33 3 100 2 Smt1-1 Cycloartenol-C-24-methyltransferase 1 Oryza sativa subsp. japonica
A7MXI3 0.000454 44 33 5 112 3 prmA Ribosomal protein L11 methyltransferase Vibrio campbellii (strain ATCC BAA-1116)
A0A0E0SMA3 0.000509 44 33 4 101 2 ERG6B Sterol 24-C-methyltransferase ERG6B Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q9Z5E9 0.000525 43 32 4 104 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (Fragment) Pseudomonas oleovorans
Q96WX4 0.000526 44 29 4 101 1 erg6 Sterol 24-C-methyltransferase Pneumocystis carinii (strain B80)
Q5KXU0 0.00053 43 31 4 116 3 menG Demethylmenaquinone methyltransferase Geobacillus kaustophilus (strain HTA426)
P0DO33 0.000532 43 30 4 110 1 iliD S-adenosyl-L-methionine-dependent Diels-Alderase iliD Neonectria sp. (strain DH2)
Q7VHY7 0.000544 43 34 1 72 3 prmA Ribosomal protein L11 methyltransferase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
I1RGC4 0.000574 44 29 4 111 2 FG02783.1 Sterol 24-C-methyltransferase ERG6A Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
B0U6V1 0.000596 43 31 6 122 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Xylella fastidiosa (strain M12)
Q4W9V1 0.000603 43 30 4 111 1 erg6 Sterol 24-C-methyltransferase erg6 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q39JS9 0.000622 43 28 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q55467 0.000654 43 29 4 124 1 chlM Magnesium-protoporphyrin O-methyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5KWZ9 0.000782 43 31 3 123 3 prmA Ribosomal protein L11 methyltransferase Geobacillus kaustophilus (strain HTA426)
A4JBD7 0.000841 43 28 5 141 3 prmA Ribosomal protein L11 methyltransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q8DGE4 0.000848 43 32 4 101 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06375
Feature type CDS
Gene ubiG
Product bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG
Location 1329524 - 1330261 (strand: 1)
Length 738 (nucleotides) / 245 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_436
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13489 Methyltransferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2227 Coenzyme transport and metabolism (H) H 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00568 2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.222 2.1.1.64] Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of cofactors
Ubiquinone biosynthesis, prokaryotes, chorismate (+ polyprenyl-PP) => ubiquinol

Protein Sequence

MNDTTRPQPSPLTANVDPAEIKKFEDVASRWWDKEGEFKPLHRINPLRLGYIQQRVNGVFGKTVLDVGCGGGILSESMAREGAIVTGLDMGAEPLQVARLHALESGTDITYVQETVEQHAEQYPQHYDVVTCMEMLEHVPDPASVIRACARLVKPGGDVVFSTINRNKKAWFMAVIAAEYILKMVPPGTHDAKKFIRPAEMIEWMNNTGLREQHIIGLHYNPLSDKFWLAPNVDVNYMLHTRFIL

Flanking regions ( +/- flanking 50bp)

CAATACGAATTCCGGCAGGTTCTGCCGCAGGAAAGAGAGAGAATAAACGAATGAACGACACCACCCGCCCGCAACCCTCCCCGCTGACCGCCAATGTCGACCCTGCTGAAATTAAAAAATTTGAGGATGTTGCCTCACGCTGGTGGGATAAAGAAGGCGAATTTAAACCTCTGCACCGGATAAATCCGCTGCGCCTGGGCTATATTCAGCAACGGGTCAACGGCGTATTCGGCAAAACGGTGCTGGATGTCGGCTGCGGCGGCGGTATTCTCTCTGAAAGCATGGCGCGTGAAGGCGCGATAGTGACCGGGCTGGATATGGGCGCAGAGCCGTTACAGGTTGCACGTCTGCACGCGCTGGAAAGCGGTACCGATATCACCTATGTGCAGGAAACGGTTGAACAGCACGCAGAACAATACCCGCAGCACTATGATGTGGTCACCTGCATGGAGATGCTGGAGCACGTACCGGACCCGGCATCTGTTATCCGCGCCTGCGCCCGTCTGGTGAAGCCCGGTGGCGATGTGGTGTTCTCAACTATCAACCGCAACAAAAAAGCCTGGTTTATGGCGGTTATTGCCGCCGAATATATTCTGAAGATGGTGCCACCCGGCACACATGACGCGAAGAAATTTATACGTCCCGCCGAAATGATTGAGTGGATGAATAATACCGGCCTGCGTGAACAACATATAATCGGCTTACACTACAATCCGTTAAGTGATAAATTCTGGCTGGCACCTAACGTAGATGTAAATTATATGTTGCATACGCGTTTTATTTTATAGTGTCAATATAATTACGGGATAGATTAATAAAACGCCAAACGAATCGCATT