Homologs in group_436

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00395 FBDBKF_00395 74.7 Morganella morganii S1 ubiG bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG
EHELCC_01150 EHELCC_01150 74.7 Morganella morganii S2 ubiG bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG
NLDBIP_02310 NLDBIP_02310 74.7 Morganella morganii S4 ubiG bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG
LHKJJB_03825 LHKJJB_03825 74.7 Morganella morganii S3 ubiG bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG
HKOGLL_03220 HKOGLL_03220 74.7 Morganella morganii S5 ubiG bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG
F4V73_RS06375 F4V73_RS06375 73.9 Morganella psychrotolerans ubiG bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG

Distribution of the homologs in the orthogroup group_436

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_436

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EZ30 0.0 514 100 0 245 3 ubiG Ubiquinone biosynthesis O-methyltransferase Proteus mirabilis (strain HI4320)
Q7N2M5 9.77e-147 412 78 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JS96 3.5e-143 403 77 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CZ4 3.5e-143 403 77 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNI8 3.5e-143 403 77 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis (strain Pestoides F)
Q1CFZ1 3.5e-143 403 77 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R284 3.5e-143 403 77 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGR6 3.5e-143 403 77 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis
B2K9A4 3.5e-143 403 77 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C9H5 3.5e-143 403 77 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKF4 3.5e-143 403 77 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8GGX8 4.11e-142 400 78 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Serratia proteamaculans (strain 568)
B5XNZ3 1.44e-140 396 73 0 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Klebsiella pneumoniae (strain 342)
A6TBT7 2.11e-140 396 73 0 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A1JLA0 1.12e-138 392 74 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A7MPA9 2.09e-137 389 74 0 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
B7UFP4 2.61e-137 388 74 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q1R9I4 1.62e-136 386 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain UTI89 / UPEC)
B7MFZ8 1.62e-136 386 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7LM95 1.77e-136 386 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7MXR3 2.04e-136 386 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O81 (strain ED1a)
P37431 2.1e-136 386 74 0 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TPG0 2.1e-136 386 74 0 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella schwarzengrund (strain CVM19633)
B4SYU8 2.1e-136 386 74 0 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella newport (strain SL254)
B4TBE3 2.1e-136 386 74 0 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella heidelberg (strain SL476)
B5FNR7 2.1e-136 386 74 0 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella dublin (strain CT_02021853)
B5EYW1 2.1e-136 386 74 0 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella agona (strain SL483)
C6DBN5 2.38e-136 385 75 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q0TFL0 2.66e-136 385 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
C0Q093 3.4e-136 385 74 0 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella paratyphi C (strain RKS4594)
B5RCA1 3.4e-136 385 74 0 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R249 3.4e-136 385 74 0 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella enteritidis PT4 (strain P125109)
Q57M77 3.4e-136 385 74 0 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella choleraesuis (strain SC-B67)
B5YX17 7.29e-136 384 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XE29 7.29e-136 384 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O157:H7
A9MJY3 9.13e-136 384 74 0 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8Z560 9.33e-136 384 73 0 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella typhi
B7NN47 1.04e-135 384 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q32DV8 1.12e-135 384 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
B7N5J4 1.12e-135 384 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P17993 1.12e-135 384 73 0 238 1 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain K12)
B1X8C6 1.12e-135 384 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain K12 / DH10B)
C4ZU73 1.12e-135 384 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
A7ZP50 1.12e-135 384 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
B1LLI3 1.95e-135 383 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
Q3YZX6 3.42e-135 383 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella sonnei (strain Ss046)
Q820C5 3.42e-135 383 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella flexneri
Q0T2P9 3.42e-135 383 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella flexneri serotype 5b (strain 8401)
B1IXV6 4.3e-135 382 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8ADY5 5.1e-135 382 73 0 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A8A296 7.28e-135 382 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O9:H4 (strain HS)
Q31Z65 9.47e-135 382 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella boydii serotype 4 (strain Sb227)
B2TW20 9.47e-135 382 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I7I7 9.47e-135 382 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain SE11)
B7M5R7 9.47e-135 382 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O8 (strain IAI1)
B7LAP9 9.47e-135 382 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain 55989 / EAEC)
A4WCN5 1.29e-134 381 72 0 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Enterobacter sp. (strain 638)
Q8FFP0 4.3e-134 380 73 0 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B5BCS0 4.82e-134 380 73 0 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella paratyphi A (strain AKU_12601)
Q5PCY1 4.82e-134 380 73 0 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q6D7X5 9.28e-134 379 75 0 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B2VIL6 1.52e-132 376 73 1 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C3LLV3 1.59e-128 366 73 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KSJ9 1.59e-128 366 73 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F1U0 1.59e-128 366 73 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q2NSL7 8.96e-128 364 72 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Sodalis glossinidius (strain morsitans)
Q7MM27 7.02e-127 362 71 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio vulnificus (strain YJ016)
Q8D8E0 7.02e-127 362 71 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio vulnificus (strain CMCP6)
B5FDT8 4.46e-126 359 71 0 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aliivibrio fischeri (strain MJ11)
Q5E5J8 5.93e-126 359 71 0 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q87ND5 2.7e-125 357 70 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VGS0 5.82e-124 354 70 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio atlanticus (strain LGP32)
A7MU79 1.36e-122 351 69 0 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio campbellii (strain ATCC BAA-1116)
Q6LPD7 3.07e-116 335 66 0 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Photobacterium profundum (strain SS9)
A4Y759 3.28e-115 332 63 0 233 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q0HIX5 7.05e-115 331 64 0 232 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella sp. (strain MR-4)
A0KWN3 1.13e-114 331 64 0 233 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella sp. (strain ANA-3)
A1RJD1 1.5e-114 330 63 0 233 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella sp. (strain W3-18-1)
Q0HV07 3.34e-114 330 63 0 233 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella sp. (strain MR-7)
A8H499 8.94e-114 328 63 0 233 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A9L2Y4 6.7e-113 326 62 0 233 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella baltica (strain OS195)
A6WNN7 6.7e-113 326 62 0 233 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella baltica (strain OS185)
A3D499 6.7e-113 326 62 0 233 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EA88 6.7e-113 326 62 0 233 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella baltica (strain OS223)
A4SM99 8.37e-113 326 64 0 226 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aeromonas salmonicida (strain A449)
Q8EEG9 1.51e-112 325 63 0 233 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B0TT38 9.9e-112 323 62 0 233 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella halifaxensis (strain HAW-EB4)
B7V9J5 4.4e-111 322 65 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain LESB58)
Q02PX7 5.42e-111 321 65 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q885T9 6.67e-111 321 65 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9HZ63 2.06e-110 320 65 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4ZQ90 6.5e-110 318 64 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas syringae pv. syringae (strain B728a)
Q48FM4 6.5e-110 318 64 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A6V2Q4 7.02e-110 318 65 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain PA7)
Q4K8M4 1.11e-109 318 64 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B0KTX4 1.4e-109 318 64 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain GB-1)
Q88M10 7.55e-109 316 64 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W7G3 7.55e-109 316 64 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A1S6C9 8.31e-109 316 63 0 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q21IR9 1.77e-108 315 63 2 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B0V5X4 3.19e-108 314 64 1 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain AYE)
B7IBN2 3.19e-108 314 64 1 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain AB0057)
B7H2Y9 3.19e-108 314 64 1 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain AB307-0294)
B0VMN8 4.29e-108 314 64 1 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain SDF)
Q1IDA6 6.96e-108 313 63 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas entomophila (strain L48)
B2I023 7.25e-108 313 63 1 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain ACICU)
C3K6J1 1.2e-107 313 62 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain SBW25)
Q3K8T6 1.27e-107 313 63 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain Pf0-1)
B1J5G4 1.43e-107 313 63 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain W619)
Q6FFY1 2.98e-107 312 63 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q3ILA5 6.32e-107 311 59 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudoalteromonas translucida (strain TAC 125)
A3MZ07 3.9e-105 306 59 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
C1DRQ3 4.48e-105 306 62 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B3H0C8 5.36e-105 306 58 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q9CMI6 1.3e-104 305 58 2 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pasteurella multocida (strain Pm70)
Q7VKW2 2.91e-103 302 58 1 233 3 ubiG Ubiquinone biosynthesis O-methyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A4VLX7 6.65e-103 301 62 1 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Stutzerimonas stutzeri (strain A1501)
Q7VZG7 5.15e-102 299 57 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WGT9 7.98e-102 298 57 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7W5Z6 3.42e-101 296 57 0 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
B0UUV6 4.28e-101 296 59 1 232 3 ubiG Ubiquinone biosynthesis O-methyltransferase Histophilus somni (strain 2336)
A1U3K1 1.32e-100 295 59 2 232 3 ubiG Ubiquinone biosynthesis O-methyltransferase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q0I3Y4 3.99e-100 294 59 1 232 3 ubiG Ubiquinone biosynthesis O-methyltransferase Histophilus somni (strain 129Pt)
Q2L2T5 4.74e-99 291 57 0 228 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella avium (strain 197N)
Q0AA73 1.47e-98 290 56 0 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q8Y0Z5 1.8e-97 287 58 1 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2SE61 3.54e-97 286 58 1 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Hahella chejuensis (strain KCTC 2396)
Q3J8U2 1.2e-96 285 56 1 226 3 ubiG Ubiquinone biosynthesis O-methyltransferase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q2Y6Z3 2.13e-96 285 58 1 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q7NZ91 3.39e-96 284 56 1 232 3 ubiG Ubiquinone biosynthesis O-methyltransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q482G8 6.61e-96 283 53 1 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q3SK91 1.22e-95 282 57 1 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Thiobacillus denitrificans (strain ATCC 25259)
Q5P7U3 3.02e-95 281 55 1 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q5QZ53 2.54e-94 279 54 0 232 3 ubiG Ubiquinone biosynthesis O-methyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q47GP8 3.2e-94 279 55 1 227 3 ubiG Ubiquinone biosynthesis O-methyltransferase Dechloromonas aromatica (strain RCB)
A1K8Q1 6.8e-94 278 56 1 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Azoarcus sp. (strain BH72)
Q21UL3 1.28e-91 273 53 2 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B2JEZ6 8.36e-91 270 56 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A1TSA0 8.49e-91 270 54 2 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paracidovorax citrulli (strain AAC00-1)
Q81ZZ2 9.45e-91 270 55 0 229 3 ubiG Ubiquinone biosynthesis O-methyltransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B8F4B1 1.31e-90 270 50 1 232 3 ubiG Ubiquinone biosynthesis O-methyltransferase Glaesserella parasuis serovar 5 (strain SH0165)
Q3BSF8 1.48e-90 270 51 1 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q13VB4 4.4e-90 268 57 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paraburkholderia xenovorans (strain LB400)
Q46Y42 2.34e-89 267 59 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B1Y2L3 4.01e-89 266 57 1 226 3 ubiG Ubiquinone biosynthesis O-methyltransferase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A4JCG7 1.13e-88 265 56 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q5GZB5 1.18e-88 265 50 1 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SHS9 1.18e-88 265 50 1 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P2C4 1.18e-88 265 50 1 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8PK00 1.41e-88 265 50 1 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas axonopodis pv. citri (strain 306)
Q8P8H2 1.83e-88 264 51 1 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RS27 1.83e-88 264 51 1 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas campestris pv. campestris (strain B100)
Q4UVL4 1.83e-88 264 51 1 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas campestris pv. campestris (strain 8004)
Q0BHA0 2.53e-88 264 56 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YV26 2.53e-88 264 56 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia ambifaria (strain MC40-6)
Q1BY35 3.02e-88 263 57 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia orbicola (strain AU 1054)
B1JXR2 3.02e-88 263 57 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia orbicola (strain MC0-3)
A0K5L4 3.02e-88 263 57 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia cenocepacia (strain HI2424)
Q63RZ8 5.5e-88 263 56 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia pseudomallei (strain K96243)
Q3JPX1 5.5e-88 263 56 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia pseudomallei (strain 1710b)
Q62M18 5.5e-88 263 56 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia mallei (strain ATCC 23344)
Q39IG8 6.01e-88 263 57 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B2T641 7.55e-88 263 56 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q2SY32 8.16e-88 263 56 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A9ADW3 1.71e-87 261 57 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia multivorans (strain ATCC 17616 / 249)
B4EB49 2.99e-87 261 56 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q609G2 1.23e-84 254 52 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q1QEI9 3.88e-84 254 52 3 244 3 ubiG Ubiquinone biosynthesis O-methyltransferase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q31GD8 1.01e-83 252 48 1 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q4FVG3 2.56e-83 252 52 3 244 3 ubiG Ubiquinone biosynthesis O-methyltransferase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q9JWE6 8.5e-83 250 55 3 226 3 ubiG Ubiquinone biosynthesis O-methyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9JXI7 2.92e-82 248 55 3 226 3 ubiG Ubiquinone biosynthesis O-methyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q87BG5 3.12e-82 249 51 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I705 3.12e-82 249 51 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain M23)
Q9PAM5 3.25e-82 249 48 1 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain 9a5c)
Q820B5 4.87e-82 248 49 2 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NBI0 4.87e-82 248 49 2 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J1W2 4.87e-82 248 49 2 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain CbuG_Q212)
B0U3W1 5.15e-82 248 50 1 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain M12)
A9M0C4 5.32e-82 248 55 3 226 3 ubiG Ubiquinone biosynthesis O-methyltransferase Neisseria meningitidis serogroup C (strain 053442)
B6J5Y2 7.14e-82 248 49 2 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain CbuK_Q154)
A9KGL7 5.67e-81 245 48 2 225 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain Dugway 5J108-111)
A7HTX8 1.05e-68 214 41 3 247 3 ubiG Ubiquinone biosynthesis O-methyltransferase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q11E01 2.81e-68 214 40 2 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Chelativorans sp. (strain BNC1)
Q2W6W0 1.15e-67 212 44 2 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A1URT5 5.17e-67 210 40 2 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q6G0I1 7.1e-67 210 40 3 246 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bartonella quintana (strain Toulouse)
A9IQF4 2.3e-65 206 40 2 235 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bartonella tribocorum (strain CIP 105476 / IBS 506)
B8H209 4.94e-65 205 40 1 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A9X1 4.94e-65 205 40 1 236 3 ubiG Ubiquinone biosynthesis O-methyltransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A4WW91 9.16e-65 204 41 3 243 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q8YJ98 1.25e-64 204 39 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RFB8 1.25e-64 204 39 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella melitensis biotype 2 (strain ATCC 23457)
Q98G87 1.31e-64 204 39 2 241 3 ubiG Ubiquinone biosynthesis O-methyltransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8FYK0 1.4e-64 204 39 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella suis biovar 1 (strain 1330)
B0CIC6 1.4e-64 204 39 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VSK3 1.4e-64 204 39 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A9M8K8 1.4e-64 204 39 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q2YLN5 1.4e-64 204 39 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella abortus (strain 2308)
B2S828 1.4e-64 204 39 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella abortus (strain S19)
B9KPP7 3.41e-64 203 41 3 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
B0UAV0 4.13e-64 203 40 2 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylobacterium sp. (strain 4-46)
B8IUB0 4.27e-64 202 40 2 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q3IYM5 4.57e-64 202 41 3 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PNM3 8.87e-64 202 41 3 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q6G5K3 2.09e-63 201 40 4 246 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q5LWM6 3.52e-63 200 43 4 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B0SW81 6.49e-63 200 38 1 245 3 ubiG Ubiquinone biosynthesis O-methyltransferase Caulobacter sp. (strain K31)
Q28VP7 7.12e-63 200 39 3 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Jannaschia sp. (strain CCS1)
A8LQ43 7.53e-63 199 41 3 239 3 ubiG Ubiquinone biosynthesis O-methyltransferase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q1GCH8 1.43e-62 199 41 3 241 3 ubiG Ubiquinone biosynthesis O-methyltransferase Ruegeria sp. (strain TM1040)
Q16D32 2.86e-62 198 41 3 241 3 ubiG Ubiquinone biosynthesis O-methyltransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q0AME1 3.12e-62 198 37 1 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Maricaulis maris (strain MCS10)
A6WXQ0 7.05e-62 197 39 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q92MK1 8.67e-62 197 39 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium meliloti (strain 1021)
B3PP83 2.51e-61 196 40 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium etli (strain CIAT 652)
Q1RJC7 6.22e-61 194 39 3 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia bellii (strain RML369-C)
A8GX11 6.22e-61 194 39 3 234 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia bellii (strain OSU 85-389)
Q21BZ6 8.27e-61 194 39 2 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain BisB18)
Q4UME7 8.55e-61 194 38 2 230 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
B5ZRR7 2e-60 193 38 2 251 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q8UA66 2.53e-60 193 38 2 245 3 ubiG Ubiquinone biosynthesis O-methyltransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
A8GPB1 2.57e-60 193 38 2 231 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia akari (strain Hartford)
Q13EZ9 3.96e-60 193 38 2 245 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain BisB5)
C3MHQ9 5.79e-60 192 38 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q2K3S8 8.1e-60 192 39 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A4YKT6 1.87e-59 191 37 2 245 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bradyrhizobium sp. (strain ORS 278)
A6UCF6 1.89e-59 191 38 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Sinorhizobium medicae (strain WSM419)
Q1MBA9 5.29e-59 190 39 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B3QCF3 5.46e-59 190 37 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain TIE-1)
Q6NC69 5.46e-59 190 37 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q2J419 8.99e-59 189 39 4 241 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain HaA2)
Q3SVP3 3.76e-58 188 38 2 241 3 ubiG Ubiquinone biosynthesis O-methyltransferase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q89XU2 4.99e-58 187 40 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9ZCT9 5.34e-58 187 36 2 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia prowazekii (strain Madrid E)
B9JB78 6.41e-58 187 38 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q68WB5 1.55e-57 186 36 2 238 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q4FNA2 1.56e-57 186 37 2 233 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pelagibacter ubique (strain HTCC1062)
B8EI29 2.96e-57 186 35 3 251 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
A8EY40 3.79e-57 184 36 2 233 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia canadensis (strain McKiel)
Q07VB6 2.1e-56 183 36 2 237 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodopseudomonas palustris (strain BisA53)
A8HVC4 4.73e-56 182 36 3 240 3 ubiG Ubiquinone biosynthesis O-methyltransferase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q2RWE9 1.75e-55 181 36 2 242 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q54XD0 2.41e-55 182 39 5 247 3 coq3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Dictyostelium discoideum
O49354 3.01e-54 180 37 4 248 1 COQ3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Arabidopsis thaliana
Q92H07 5.31e-52 173 32 3 279 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
O74421 7.92e-51 169 40 6 240 3 coq3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9NZJ6 4.77e-46 160 32 2 241 1 COQ3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Homo sapiens
Q63159 8.23e-46 159 32 2 246 2 Coq3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Rattus norvegicus
Q8BMS4 1.1e-45 159 33 2 244 1 Coq3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Mus musculus
Q3T131 4.27e-45 157 33 2 239 2 COQ3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Bos taurus
O93995 6.87e-37 135 31 8 283 3 COQ3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Candida albicans
P27680 1.6e-35 131 31 7 267 1 COQ3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P08442 1.34e-08 58 28 4 127 4 syc1184_c Uncharacterized protein syc1184_c Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
B9L8G5 3.54e-08 56 23 5 178 3 cmoB tRNA U34 carboxymethyltransferase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q5R0Q5 9.94e-08 55 29 5 139 3 cmoB tRNA U34 carboxymethyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A7I1I7 1.56e-07 54 31 5 121 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q9C6B9 6.08e-07 53 30 3 112 1 NMT3 Phosphoethanolamine N-methyltransferase 3 Arabidopsis thaliana
P9WEU0 6.82e-07 52 27 2 113 1 iliD S-adenosyl-L-methionine-dependent Diels-Alderase iliD Hypocrea jecorina (strain QM6a)
G0FUS0 8.08e-07 52 28 2 101 1 RAM_03320 27-O-demethylrifamycin SV methyltransferase Amycolatopsis mediterranei (strain S699)
Q9M571 1.46e-06 52 32 3 104 1 PEAMT Phosphoethanolamine N-methyltransferase Spinacia oleracea
O94628 1.54e-06 51 23 1 111 3 SPBC1347.09 Uncharacterized methyltransferase C1347.09 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P54458 1.56e-06 51 27 2 111 3 yqeM Putative methyltransferase YqeM Bacillus subtilis (strain 168)
Q9K623 1.73e-06 51 28 3 107 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5QYG2 2.31e-06 50 31 8 174 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q9FR44 2.37e-06 51 30 4 113 1 NMT1 Phosphoethanolamine N-methyltransferase 1 Arabidopsis thaliana
Q9ZSK1 2.62e-06 51 29 4 129 1 VTE4 Tocopherol O-methyltransferase, chloroplastic Arabidopsis thaliana
A0A1D6NER6 3.39e-06 51 32 3 104 2 PEAMT1 Phosphoethanolamine N-methyltransferase 1 Zea mays
P67064 3.55e-06 50 30 3 100 3 menG Demethylmenaquinone methyltransferase Tropheryma whipplei (strain Twist)
P67065 3.55e-06 50 30 3 100 3 menG Demethylmenaquinone methyltransferase Tropheryma whipplei (strain TW08/27)
A1SAJ8 3.62e-06 50 30 9 171 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
H2E7T5 3.75e-06 50 33 3 100 1 TMT-1 Squalene methyltransferase 1 Botryococcus braunii
C8YTM5 3.76e-06 50 31 3 109 1 PEAMT2 Phosphoethanolamine N-methyltransferase Triticum aestivum
A0A8X8M4W6 4.26e-06 50 31 4 106 2 TMT3 Gamma-tocopherol methyltransferase, chloroplastic Catharanthus roseus
Q89AK7 4.96e-06 49 21 7 230 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q7VHY7 6.43e-06 49 29 2 91 3 prmA Ribosomal protein L11 methyltransferase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
O31474 6.8e-06 49 30 3 101 1 ycgJ Uncharacterized methyltransferase YcgJ Bacillus subtilis (strain 168)
A0QUV5 6.95e-06 49 30 2 109 1 MSMEG_2350 Probable S-adenosylmethionine-dependent methyltransferase MSMEG_2350/MSMEI_2290 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q603L5 7.95e-06 49 25 5 191 3 cmoB tRNA U34 carboxymethyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8VHT6 1.38e-05 48 30 5 115 1 As3mt Arsenite methyltransferase Rattus norvegicus
U2ZU49 1.55e-05 48 31 5 125 1 arsM Arsenite methyltransferase Pseudomonas alcaligenes (strain ATCC 14909 / DSM 50342 / JCM 20561 / NBRC 14159 / NCIMB 9945 / NCTC 10367 / 1577)
A3QIE1 1.88e-05 48 28 6 145 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A5G9G5 2.22e-05 48 31 5 115 3 prmA Ribosomal protein L11 methyltransferase Geotalea uraniireducens (strain Rf4)
A8G0S7 2.33e-05 47 30 7 143 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sediminis (strain HAW-EB3)
Q31JJ8 2.42e-05 48 28 3 121 3 cmoB tRNA U34 carboxymethyltransferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A7Z627 2.49e-05 47 27 8 161 3 menG Demethylmenaquinone methyltransferase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A9WRT1 2.65e-05 47 24 5 158 3 menG Demethylmenaquinone methyltransferase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
B0TJ16 2.68e-05 47 28 6 143 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella halifaxensis (strain HAW-EB4)
Q65I24 2.98e-05 47 32 4 106 3 menG Demethylmenaquinone methyltransferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B1KR07 3e-05 47 27 6 151 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella woodyi (strain ATCC 51908 / MS32)
Q55423 4.29e-05 46 32 2 98 3 sll0829 Uncharacterized methyltransferase sll0829 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8CWG0 4.42e-05 47 33 4 106 3 menG Demethylmenaquinone methyltransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B8DBZ5 4.56e-05 47 28 8 188 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4a (strain HCC23)
Q05197 4.76e-05 46 24 5 177 4 pmtA Phosphatidylethanolamine N-methyltransferase Cereibacter sphaeroides
Q7MQ33 5.18e-05 47 32 4 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio vulnificus (strain YJ016)
Q8DDP9 5.18e-05 47 32 4 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio vulnificus (strain CMCP6)
P67055 5.81e-05 46 28 9 195 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71Y84 5.81e-05 46 28 9 195 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4b (strain F2365)
C1KWN1 5.81e-05 46 28 9 195 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4b (strain CLIP80459)
P67056 5.81e-05 46 28 9 195 3 menG Demethylmenaquinone methyltransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P74388 5.99e-05 47 33 4 109 1 sll0418 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B8E6B6 6.27e-05 46 27 7 167 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS223)
Q8VYX1 6.79e-05 47 30 3 109 1 PEAMT1 Phosphoethanolamine N-methyltransferase 1 Triticum aestivum
P9WKL5 6.84e-05 46 28 2 115 1 htm 2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WKL4 6.84e-05 46 28 2 115 3 htm 2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5TZU0 6.84e-05 46 28 2 115 1 htm 2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A1KG37 6.84e-05 46 28 2 115 1 htm 2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
A0AK43 6.96e-05 46 28 9 195 3 menG Demethylmenaquinone methyltransferase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
H2E7T9 7.38e-05 47 26 6 167 2 SMT-2 Sterol methyltransferase-like 2 Botryococcus braunii
P31113 7.87e-05 46 25 6 159 1 menG Demethylmenaquinone methyltransferase Bacillus subtilis (strain 168)
A8H966 8.21e-05 46 27 7 169 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A7GXW7 8.44e-05 46 25 2 115 3 cmoB tRNA U34 carboxymethyltransferase Campylobacter curvus (strain 525.92)
A1AVT4 8.65e-05 46 23 6 164 3 cmoB tRNA U34 carboxymethyltransferase Ruthia magnifica subsp. Calyptogena magnifica
Q478R6 8.87e-05 46 34 6 108 3 prmA Ribosomal protein L11 methyltransferase Dechloromonas aromatica (strain RCB)
L0E172 9.22e-05 46 28 4 113 3 phqN Methyltransferase phqN Penicillium fellutanum
Q12S23 9.52e-05 46 28 7 160 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q944H0 9.82e-05 46 28 3 109 1 NMT2 Phosphoethanolamine N-methyltransferase 2 Arabidopsis thaliana
Q6LLY5 0.000101 46 28 3 107 3 prmA Ribosomal protein L11 methyltransferase Photobacterium profundum (strain SS9)
Q088H8 0.000105 45 31 7 136 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella frigidimarina (strain NCIMB 400)
A7MTX1 0.000113 45 32 4 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio campbellii (strain ATCC BAA-1116)
B8CI06 0.000114 45 27 8 182 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella piezotolerans (strain WP3 / JCM 13877)
A9KYL8 0.000117 45 28 7 160 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS195)
A6WIE9 0.000117 45 28 7 160 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS185)
A3D9F2 0.000117 45 28 7 160 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q8E9R7 0.000122 45 30 8 160 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q3IIC0 0.000124 45 27 5 126 3 prmA Ribosomal protein L11 methyltransferase Pseudoalteromonas translucida (strain TAC 125)
B7GHP8 0.000126 45 27 7 188 3 menG Demethylmenaquinone methyltransferase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A1RP78 0.000134 45 31 4 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain W3-18-1)
A4Y2Q5 0.000134 45 31 4 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
C5D3E5 0.000147 45 33 4 104 3 menG Demethylmenaquinone methyltransferase Geobacillus sp. (strain WCH70)
Q0HZP7 0.000162 45 28 7 160 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain MR-7)
Q0HEA1 0.000162 45 28 7 160 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain MR-4)
A0L1M4 0.000162 45 28 7 160 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain ANA-3)
P65347 0.000162 45 29 4 116 3 BQ2027_MB0092 Uncharacterized methyltransferase Mb0092 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WK03 0.000162 45 29 4 116 3 Rv0089 Uncharacterized methyltransferase Rv0089 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WK02 0.000162 45 29 4 116 3 MT0098 Uncharacterized methyltransferase MT0098 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7VL11 0.000172 45 22 4 128 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P9WJZ1 0.000176 45 26 6 173 1 Rv3030 Probable S-adenosylmethionine-dependent methyltransferase Rv3030 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJZ0 0.000176 45 26 6 173 3 MT3114 Probable S-adenosylmethionine-dependent methyltransferase MT3114 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
C3LPS5 0.000178 45 30 4 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain M66-2)
Q9KVQ6 0.000178 45 30 4 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4E5 0.000178 45 30 4 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
E5KIC0 0.000181 45 27 3 109 1 cypM Cypemycin N-terminal methyltransferase Streptomyces sp.
Q6ZIK0 0.000182 45 32 8 114 2 VTE4 Probable tocopherol O-methyltransferase, chloroplastic Oryza sativa subsp. japonica
Q87TH4 0.000196 45 31 4 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6ZIX2 0.000197 45 34 3 100 2 Smt1-1 Cycloartenol-C-24-methyltransferase 1 Oryza sativa subsp. japonica
Q8DD03 0.000197 45 32 4 111 3 prmA Ribosomal protein L11 methyltransferase Vibrio vulnificus (strain CMCP6)
P60094 0.000199 45 32 4 111 3 prmA Ribosomal protein L11 methyltransferase Vibrio vulnificus (strain YJ016)
Q9XAP8 0.000207 45 26 7 181 3 menG Demethylmenaquinone methyltransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A6Q3V1 0.000214 45 24 4 120 3 cmoB tRNA U34 carboxymethyltransferase Nitratiruptor sp. (strain SB155-2)
A1SRS4 0.000216 45 31 5 114 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A4VGE5 0.00022 45 25 8 177 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Stutzerimonas stutzeri (strain A1501)
Q5E9L5 0.00022 45 35 5 122 2 PRMT6 Protein arginine N-methyltransferase 6 Bos taurus
Q6NWG4 0.00023 45 30 5 125 2 prmt6 Protein arginine N-methyltransferase 6 Danio rerio
C5D4V7 0.00023 45 26 3 105 3 GWCH70_2453 Putative methyltransferase GWCH70_2453 Geobacillus sp. (strain WCH70)
Q22993 0.000248 45 29 5 118 1 pmt-2 Phosphoethanolamine N-methyltransferase 2 Caenorhabditis elegans
Q9SW18 0.000263 45 26 3 121 1 CHLM Magnesium protoporphyrin IX methyltransferase, chloroplastic Arabidopsis thaliana
C6DI77 0.000269 44 30 4 105 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C5BCA4 0.000282 44 31 5 112 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Edwardsiella ictaluri (strain 93-146)
Q5APD4 0.000284 45 24 4 137 1 MTS1 Sphingolipid C9-methyltransferase Candida albicans (strain SC5314 / ATCC MYA-2876)
Q8KZ94 0.000304 44 30 4 105 1 rebM Demethylrebeccamycin-D-glucose O-methyltransferase Lentzea aerocolonigenes
E3G327 0.000309 44 27 5 135 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Enterobacter lignolyticus (strain SCF1)
Q8XDG3 0.000314 44 22 3 162 1 cmoM tRNA 5-carboxymethoxyuridine methyltransferase Escherichia coli O157:H7
P36566 0.00032 44 22 3 162 1 cmoM tRNA 5-carboxymethoxyuridine methyltransferase Escherichia coli (strain K12)
Q4W9V1 0.000333 44 29 4 101 1 erg6 Sterol 24-C-methyltransferase erg6 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q21JL7 0.000341 44 26 7 164 3 cmoB tRNA U34 carboxymethyltransferase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
D8MPW4 0.000349 44 30 3 109 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Erwinia billingiae (strain Eb661)
Q91WU5 0.000352 44 28 5 115 1 As3mt Arsenite methyltransferase Mus musculus
B3QLI9 0.000352 44 29 5 131 3 menG Demethylmenaquinone methyltransferase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B6ENA3 0.000353 44 28 5 128 3 prmA Ribosomal protein L11 methyltransferase Aliivibrio salmonicida (strain LFI1238)
Q8CSH9 0.000375 44 34 5 106 3 menG Demethylmenaquinone methyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HP74 0.000375 44 34 5 106 3 menG Demethylmenaquinone methyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q74G05 0.0004 44 32 3 112 3 prmA Ribosomal protein L11 methyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q759S7 0.00042 44 29 4 112 3 ERG6 Sterol 24-C-methyltransferase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
A0PQX0 0.000422 44 27 4 109 3 MUL_2377 Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 1 Mycobacterium ulcerans (strain Agy99)
B3PI89 0.000432 44 25 4 131 3 bioC Biotin biosynthesis bifunctional protein BioHC Cellvibrio japonicus (strain Ueda107)
Q0AWM5 0.000455 44 28 6 135 3 prmA Ribosomal protein L11 methyltransferase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q6DAQ7 0.000456 43 30 4 105 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8KF69 0.000458 43 29 6 134 3 menG Demethylmenaquinone methyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q75G68 0.000469 44 31 5 125 2 PRMT6.2 Probable protein arginine N-methyltransferase 6.2 Oryza sativa subsp. japonica
A2Z8S0 0.000469 44 31 5 125 3 PRMT6.2 Probable protein arginine N-methyltransferase 6.2 Oryza sativa subsp. indica
P0DO33 0.000476 43 28 3 108 1 iliD S-adenosyl-L-methionine-dependent Diels-Alderase iliD Neonectria sp. (strain DH2)
B3PFU1 0.00052 44 24 5 161 3 cmoB tRNA U34 carboxymethyltransferase Cellvibrio japonicus (strain Ueda107)
P46326 0.000527 43 27 2 100 3 yxbB Uncharacterized protein YxbB Bacillus subtilis (strain 168)
A7MXI3 0.000545 43 31 4 111 3 prmA Ribosomal protein L11 methyltransferase Vibrio campbellii (strain ATCC BAA-1116)
C4R7Z3 0.000598 44 25 4 144 1 PAS_chr4_0465 Sphingolipid C9-methyltransferase Komagataella phaffii (strain GS115 / ATCC 20864)
Q7MZ81 0.000625 43 29 4 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8G8B8 0.00063 43 31 4 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Serratia proteamaculans (strain 568)
Q6C2D9 0.000634 43 31 4 101 3 ERG6 Sterol 24-C-methyltransferase Yarrowia lipolytica (strain CLIB 122 / E 150)
B4EWC9 0.000673 43 28 7 145 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Proteus mirabilis (strain HI4320)
A0A8X8M505 0.000711 43 24 3 109 1 PeNMT Perivine-Nbeta-methyltransferase Catharanthus roseus
Q5N4X9 0.000716 43 28 4 114 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31P90 0.000716 43 28 4 114 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q6FRZ7 0.000731 43 28 3 100 3 ERG6 Sterol 24-C-methyltransferase Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
A0A075D5I4 0.000741 43 27 4 111 1 PiNMT Picrinine-N-methytransferase Rauvolfia serpentina
Q6GGU0 0.000745 43 33 5 106 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain MRSA252)
A1JIF2 0.000751 43 32 5 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P59911 0.000762 43 30 3 105 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q6NZB1 0.000778 43 35 5 122 1 Prmt6 Protein arginine N-methyltransferase 6 Mus musculus
A8FEK9 0.000797 43 34 5 106 3 menG Demethylmenaquinone methyltransferase Bacillus pumilus (strain SAFR-032)
C1DHS2 0.000801 43 26 7 174 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q54818 0.00088 43 28 4 114 1 dnrC Aklanonic acid methyltransferase DnrC Streptomyces peucetius
C3LQP9 0.000894 43 30 5 110 3 prmA Ribosomal protein L11 methyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q55467 0.001 43 33 4 104 1 chlM Magnesium-protoporphyrin O-methyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A6VDI6 0.001 43 29 4 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain PA7)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08505
Feature type CDS
Gene -
Product bifunctional 3-demethylubiquinone 3-O-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase
Location 1854466 - 1855203 (strand: 1)
Length 738 (nucleotides) / 245 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_436
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13489 Methyltransferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2227 Coenzyme transport and metabolism (H) H 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00568 2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.222 2.1.1.64] Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of cofactors		 Ubiquinone biosynthesis, prokaryotes, chorismate (+ polyprenyl-PP) => ubiquinol

Protein Sequence

MNDKTTSLHANVDQHEIDKFESVASRWWDLEGEFKPLHRINPLRLNYIQERADGLFGKKVLDVGCGGGILSESMARVGAEVTGLDMGKEPLEVARLHSLETGIPVTYIQDTVENHAAEYPQRYDVVTCMEMLEHVPDPSSIVRSCAKLVKPGGHVFFSTINRNKKAWFMLVVGAEYILNMVPKGTHDANKFIRPSELLSWVDETNLRSKNMIGLHYNPITDKFRLAPNVDVNYMVHTQATDNSDL

Flanking regions ( +/- flanking 50bp)

TAACATTGGTAGAATCATCGGTAATATGAAAATAGGAGTAATACTTTCTGATGAATGATAAAACAACCTCTTTGCATGCTAACGTAGATCAGCATGAAATCGACAAATTTGAGAGTGTCGCATCAAGATGGTGGGATCTTGAAGGTGAATTTAAACCCCTACATCGCATCAATCCACTAAGACTTAATTATATCCAAGAACGTGCTGATGGCTTATTTGGTAAAAAAGTACTCGATGTTGGGTGTGGTGGCGGTATTTTATCTGAAAGTATGGCCCGTGTTGGTGCAGAAGTCACCGGACTCGATATGGGGAAAGAGCCATTAGAAGTCGCACGTCTCCACTCACTGGAAACCGGTATCCCTGTCACCTATATACAAGATACCGTTGAAAACCATGCCGCAGAATATCCACAACGCTATGATGTGGTCACTTGTATGGAAATGTTAGAACACGTTCCAGACCCTTCCTCCATTGTAAGATCATGTGCCAAACTGGTGAAACCAGGTGGACATGTATTCTTTTCTACCATCAACCGTAATAAAAAAGCGTGGTTTATGCTGGTGGTAGGCGCGGAGTATATTCTGAATATGGTTCCTAAAGGCACCCATGATGCGAATAAATTTATTCGTCCTTCAGAATTATTAAGCTGGGTCGATGAAACCAATTTACGTAGCAAAAATATGATTGGGTTACATTACAATCCTATTACAGACAAATTCCGATTAGCGCCAAATGTTGATGTTAATTACATGGTGCACACTCAAGCGACCGATAATTCGGATTTGTGAAATAGAGAGATTGATTTGGTTTAATAAAACATCAAACGATCACATTTTTA