Homologs in group_272

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05360 FBDBKF_05360 100.0 Morganella morganii S1 galU UTP--glucose-1-phosphate uridylyltransferase GalU
EHELCC_12230 EHELCC_12230 100.0 Morganella morganii S2 galU UTP--glucose-1-phosphate uridylyltransferase GalU
NLDBIP_12570 NLDBIP_12570 100.0 Morganella morganii S4 galU UTP--glucose-1-phosphate uridylyltransferase GalU
LHKJJB_12430 LHKJJB_12430 100.0 Morganella morganii S3 galU UTP--glucose-1-phosphate uridylyltransferase GalU
F4V73_RS05815 F4V73_RS05815 94.7 Morganella psychrotolerans galU UTP--glucose-1-phosphate uridylyltransferase GalU
PMI_RS07215 PMI_RS07215 77.4 Proteus mirabilis HI4320 galU UTP--glucose-1-phosphate uridylyltransferase GalU
PMI_RS15355 PMI_RS15355 59.9 Proteus mirabilis HI4320 galU UTP--glucose-1-phosphate uridylyltransferase GalU

Distribution of the homologs in the orthogroup group_272

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_272

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEP6 1.3e-166 467 76 1 297 1 galU UTP--glucose-1-phosphate uridylyltransferase Shigella flexneri
P0AEP3 1.3e-166 467 76 1 297 1 galU UTP--glucose-1-phosphate uridylyltransferase Escherichia coli (strain K12)
P0AEP4 1.3e-166 467 76 1 297 3 galU UTP--glucose-1-phosphate uridylyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEP5 1.3e-166 467 76 1 297 3 galU UTP--glucose-1-phosphate uridylyltransferase Escherichia coli O157:H7
P44878 1.09e-150 426 69 0 290 3 galU UTP--glucose-1-phosphate uridylyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9F664 1.13e-140 401 65 0 290 3 galU UTP--glucose-1-phosphate uridylyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q48447 1.76e-116 340 58 2 291 3 galF UTP--glucose-1-phosphate uridylyltransferase Klebsiella pneumoniae
P0AAB6 2.1e-115 337 58 2 291 1 galF UTP--glucose-1-phosphate uridylyltransferase Escherichia coli (strain K12)
P0AAB7 2.1e-115 337 58 2 291 3 galF UTP--glucose-1-phosphate uridylyltransferase Escherichia coli O157:H7
P37776 1.97e-114 335 57 2 291 3 galF UTP--glucose-1-phosphate uridylyltransferase Shigella flexneri
P0A2K7 7.81e-112 328 56 2 291 3 galF UTP--glucose-1-phosphate uridylyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2K8 7.81e-112 328 56 2 291 3 galF UTP--glucose-1-phosphate uridylyltransferase Salmonella typhi
P0DG73 5.97e-79 244 44 4 294 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M3 (strain SSI-1)
P67070 5.97e-79 244 44 4 294 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0DG72 5.97e-79 244 44 4 294 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P67068 5.97e-79 244 44 4 294 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M1
Q5XE04 5.97e-79 244 44 4 294 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q49VP4 9.33e-79 244 45 4 294 3 gtaB2 UTP--glucose-1-phosphate uridylyltransferase 2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P58313 1.11e-78 244 45 4 292 3 cap4C UTP--glucose-1-phosphate uridylyltransferase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8NUU9 2.59e-78 243 44 3 293 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain MW2)
Q6G6H5 2.59e-78 243 44 3 293 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain MSSA476)
Q7A3J9 3.02e-78 242 44 3 293 1 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain N315)
Q99RD4 3.02e-78 242 44 3 293 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HD54 3.02e-78 242 44 3 293 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain COL)
Q2G1T6 3.02e-78 242 44 3 293 1 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FE05 3.02e-78 242 44 3 293 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain USA300)
Q6GDU6 4.05e-78 242 44 3 293 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain MRSA252)
Q8CR67 6.05e-78 241 44 3 293 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLD1 6.05e-78 241 44 3 293 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0C0I8 6.53e-78 242 43 3 291 3 hasC UTP--glucose-1-phosphate uridylyltransferase Streptococcus pyogenes
Q8NKW9 6.53e-78 242 43 3 291 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9A7 8.2e-78 242 43 3 291 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DG71 8.2e-78 242 43 3 291 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DG70 8.2e-78 242 43 3 291 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0C0I9 8.38e-78 242 43 3 291 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M1
Q2YW63 1.59e-77 241 44 3 293 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q05852 1.82e-77 240 45 3 296 1 gtaB UTP--glucose-1-phosphate uridylyltransferase Bacillus subtilis (strain 168)
Q4L8Y7 3.22e-76 237 43 3 294 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus haemolyticus (strain JCSC1435)
Q4A122 5.85e-76 236 43 5 296 3 gtaB1 UTP--glucose-1-phosphate uridylyltransferase 1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q54800 1.41e-75 236 43 4 294 3 cap3C UTP--glucose-1-phosphate uridylyltransferase Streptococcus pneumoniae
O31822 3.1e-72 227 43 4 294 1 yngB UTP--glucose-1-phosphate uridylyltransferase YngB Bacillus subtilis (strain 168)
Q9I291 6.65e-71 223 45 5 275 1 galU UTP--glucose-1-phosphate uridylyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P33696 2.86e-68 217 42 3 282 3 exoN UTP--glucose-1-phosphate uridylyltransferase Rhizobium meliloti (strain 1021)
Q58730 1.96e-67 214 41 6 293 3 MJ1334 Putative UTP--glucose-1-phosphate uridylyltransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q59633 7.04e-66 210 43 4 270 3 galU UTP--glucose-1-phosphate uridylyltransferase Pseudomonas aeruginosa
P27897 1.6e-65 209 40 3 280 3 celA UTP--glucose-1-phosphate uridylyltransferase Komagataeibacter xylinus
P47691 8.46e-57 187 38 4 287 3 galU UTP--glucose-1-phosphate uridylyltransferase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P75124 7.55e-55 182 39 4 279 3 galU UTP--glucose-1-phosphate uridylyltransferase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P42407 4.02e-44 154 37 7 269 3 ytdA Putative UTP--glucose-1-phosphate uridylyltransferase Bacillus subtilis (strain 168)
A6VG23 1.23e-18 88 29 8 259 3 MmarC7_0329 Bifunctional protein GlmU Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
D4GU70 1.27e-18 88 26 8 263 3 agl11 Low-salt glycan biosynthesis nucleotidyltransferase Agl11 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
A4FX98 2.84e-17 84 29 8 259 3 MmarC5_0513 Bifunctional protein GlmU Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
A6UUQ4 6.09e-17 84 27 6 260 3 Maeo_0642 Bifunctional protein GlmU Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
D4GYH1 7.91e-16 78 26 7 262 1 aglF UTP--glucose-1-phosphate uridylyltransferase AglF Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q58501 3.11e-15 79 28 8 259 1 glmU Bifunctional protein GlmU Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A6UP85 7.39e-15 77 28 10 264 3 Mevan_0399 Bifunctional protein GlmU Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q6LYB5 6.51e-14 75 29 9 260 3 MMP1076 Bifunctional protein GlmU Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
P39629 1.37e-13 72 23 7 261 1 rmlA Glucose-1-phosphate thymidylyltransferase Bacillus subtilis (strain 168)
P37779 6.5e-13 71 26 12 279 3 rfbA Glucose-1-phosphate thymidylyltransferase 1 Shigella flexneri
P37744 7.16e-13 70 28 14 281 1 rfbA Glucose-1-phosphate thymidylyltransferase 1 Escherichia coli (strain K12)
P55254 3.76e-12 68 27 12 279 3 rmlA Glucose-1-phosphate thymidylyltransferase Salmonella anatum
P55255 5.21e-12 68 26 10 255 3 rmlA1 Glucose-1-phosphate thymidylyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P55253 7.68e-12 68 27 14 283 1 rmlA Glucose-1-phosphate thymidylyltransferase Escherichia coli
P57040 1.29e-11 67 25 10 255 3 rmlA1 Glucose-1-phosphate thymidylyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P26393 1.35e-11 67 27 12 279 1 rmlA Glucose-1-phosphate thymidylyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q975F9 5.08e-11 66 28 11 262 1 STK_04520 Bifunctional sugar-1-phosphate nucleotidylyltransferase/acetyltransferase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
P55257 5.78e-11 65 24 10 257 3 rmlA Glucose-1-phosphate thymidylyltransferase Yersinia enterocolitica
P0C7J4 1.6e-10 64 27 10 242 3 rmlA Glucose-1-phosphate thymidylyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RVK9 1.6e-10 64 27 10 242 3 rmlA Glucose-1-phosphate thymidylyltransferase Xanthomonas campestris pv. campestris (strain B100)
Q9L9E6 2.18e-10 63 24 8 240 3 novV Glucose-1-phosphate thymidylyltransferase Streptomyces niveus
A2VD83 3.1e-10 63 25 10 288 2 gmppb-b Mannose-1-phosphate guanyltransferase beta-B Xenopus laevis
P37762 6.99e-10 62 24 11 259 3 rmlA Glucose-1-phosphate thymidylyltransferase Neisseria gonorrhoeae
P08075 7.4e-10 62 24 9 263 3 strD Glucose-1-phosphate thymidylyltransferase Streptomyces griseus
P95778 2.11e-09 60 25 9 239 3 rmlA Glucose-1-phosphate thymidylyltransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P74285 3.22e-09 60 24 6 218 1 cugP UTP--glucose-1-phosphate uridylyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P61888 3.69e-09 60 25 11 261 3 rffH Glucose-1-phosphate thymidylyltransferase 2 Shigella flexneri
P61887 3.69e-09 60 25 11 261 1 rffH Glucose-1-phosphate thymidylyltransferase 2 Escherichia coli (strain K12)
Q68EY9 4.97e-09 60 24 11 297 2 gmppb-a Mannose-1-phosphate guanyltransferase beta-A Xenopus laevis
Q68EQ1 1.68e-08 58 24 11 297 2 gmppb Mannose-1-phosphate guanylyltransferase catalytic subunit beta Xenopus tropicalis
Q88QT2 1.86e-08 57 28 1 132 1 murU N-acetylmuramate alpha-1-phosphate uridylyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9RR29 1.98e-08 58 24 7 262 3 oleS Glucose-1-phosphate thymidylyltransferase Streptomyces antibioticus
Q9ZAE7 2.32e-08 57 22 10 284 3 acbA Glucose-1-phosphate thymidylyltransferase Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110)
Q6DBU5 8.31e-08 56 26 7 216 1 gmppb Mannose-1-phosphate guanylyltransferase catalytic subunit beta Danio rerio
Q8BTZ7 9.89e-08 56 25 13 305 1 Gmppb Mannose-1-phosphate guanylyltransferase catalytic subunit beta Mus musculus
P9WH13 1.43e-07 55 28 10 220 1 rmlA Glucose-1-phosphate thymidylyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WH12 1.43e-07 55 28 10 220 3 rmlA Glucose-1-phosphate thymidylyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9M2S0 2.15e-07 55 28 7 178 2 At3g55590 Probable mannose-1-phosphate guanylyltransferase 2 Arabidopsis thaliana
Q1DC47 3.75e-07 54 23 10 262 3 glgC Glucose-1-phosphate adenylyltransferase Myxococcus xanthus (strain DK1622)
A0QPF9 3.9e-07 53 26 9 233 1 rmlA Glucose-1-phosphate thymidylyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9JXY0 4.14e-07 53 31 4 137 3 murU N-acetylmuramate alpha-1-phosphate uridylyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
O22287 4.74e-07 54 28 7 178 1 CYT1 Mannose-1-phosphate guanylyltransferase 1 Arabidopsis thaliana
O06486 4.78e-07 53 27 4 168 3 yfnH Probable glucose-1-phosphate cytidylyltransferase Bacillus subtilis (strain 168)
P0C5I2 5e-07 53 27 10 227 1 GMPPB Mannose-1-phosphate guanylyltransferase catalytic subunit beta Sus scrofa
Q4I1Y5 8.78e-07 53 23 10 279 3 MPG1 Mannose-1-phosphate guanyltransferase Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q2YDJ9 9.1e-07 53 25 12 284 2 GMPPB Mannose-1-phosphate guanylyltransferase catalytic subunit beta Bos taurus
Q9Y5P6 1.18e-06 52 24 13 299 1 GMPPB Mannose-1-phosphate guanylyltransferase catalytic subunit beta Homo sapiens
Q0P8J1 3.03e-06 50 35 0 67 1 hddC D-glycero-alpha-D-manno-heptose 1-phosphate guanylyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q0VFM6 3.09e-06 52 24 9 245 2 gmppa Mannose-1-phosphate guanylyltransferase regulatory subunit alpha Xenopus tropicalis
A9FSV7 4.86e-06 51 30 4 116 3 glmU Bifunctional protein GlmU Sorangium cellulosum (strain So ce56)
Q87HX3 5.25e-06 51 23 13 292 3 glgC2 Glucose-1-phosphate adenylyltransferase 2 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
O74484 5.31e-06 50 26 12 281 2 mpg1 Mannose-1-phosphate guanyltransferase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O74624 8.99e-06 50 26 5 175 1 mpg1 Mannose-1-phosphate guanyltransferase Hypocrea jecorina
Q66KG5 9.58e-06 50 24 9 248 2 gmppa-b Mannose-1-phosphate guanyltransferase alpha-B Xenopus laevis
Q8DPI6 1.86e-05 48 43 0 51 1 licC Choline-phosphate cytidylyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q54K39 1.97e-05 49 24 7 199 2 gmppB Mannose-1-phosphate guanylyltransferase catalytic subunit beta Dictyostelium discoideum
Q6Z9A3 2.12e-05 49 26 7 178 2 Os08g0237200 Probable mannose-1-phosphate guanylyltransferase 3 Oryza sativa subsp. japonica
Q941T9 2.22e-05 48 26 7 178 2 Os01g0847200 Probable mannose-1-phosphate guanylyltransferase 2 Oryza sativa subsp. japonica
B9CM12 2.43e-05 48 43 0 51 1 pntC 2-aminoethylphosphonate cytidylyltransferase Lancefieldella rimae (strain ATCC 49626 / DSM 7090 / CCUG 31168 / NBRC 15546 / VPI D140H-11A)
Q6DKE9 3.35e-05 48 25 9 227 2 gmppa-a Mannose-1-phosphate guanyltransferase alpha-A Xenopus laevis
Q8Z5I4 3.36e-05 48 22 4 189 1 rfbF Glucose-1-phosphate cytidylyltransferase Salmonella typhi
Q84JH5 3.68e-05 48 25 7 184 2 Os03g0268400 Probable mannose-1-phosphate guanylyltransferase 1 Oryza sativa subsp. japonica
P26396 3.86e-05 47 22 4 189 3 rfbF Glucose-1-phosphate cytidylyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A7H6H5 4.56e-05 48 22 10 257 3 glgC Glucose-1-phosphate adenylyltransferase Anaeromyxobacter sp. (strain Fw109-5)
Q2UJU5 5.03e-05 48 27 3 146 3 mpg1 Mannose-1-phosphate guanyltransferase Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q295Y7 5.73e-05 47 23 11 280 3 GA10892 Mannose-1-phosphate guanylyltransferase catalytic subunit beta Drosophila pseudoobscura pseudoobscura
Q3AFM0 6.41e-05 47 25 10 252 3 glmU Bifunctional protein GlmU Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q9AGY6 6.43e-05 47 32 0 67 1 hddC D-glycero-alpha-D-manno-heptose 1-phosphate guanylyltransferase Aneurinibacillus thermoaerophilus
Q9KLP4 6.6e-05 47 23 14 291 3 glgC2 Glucose-1-phosphate adenylyltransferase 2 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P55464 8.25e-05 47 40 0 52 3 rmlA Probable glucose-1-phosphate thymidylyltransferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P32501 9.74e-05 47 33 0 66 1 GCD6 Translation initiation factor eIF2B subunit epsilon Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q752H4 0.000103 47 23 13 284 3 MPG1 Mannose-1-phosphate guanyltransferase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q5B1J4 0.000124 46 26 2 149 3 mpg1 Mannose-1-phosphate guanyltransferase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q4U3E8 0.000194 46 27 3 146 2 mpg1 Mannose-1-phosphate guanyltransferase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
L7N6A5 0.000208 46 35 0 73 1 manB Mannose-1-phosphate guanylyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
B9L1J9 0.00024 45 22 8 270 3 glgC Glucose-1-phosphate adenylyltransferase Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
Q6CCU3 0.000258 45 27 3 144 3 MPG1 Mannose-1-phosphate guanyltransferase Yarrowia lipolytica (strain CLIB 122 / E 150)
Q70SJ2 0.000261 45 23 12 274 1 MPG1 Mannose-1-phosphate guanyltransferase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q0P8J8 0.000276 45 34 0 63 1 Cj1416c CTP:phosphoglutamine cytidylyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P70541 0.000346 45 44 0 52 2 Eif2b3 Translation initiation factor eIF2B subunit gamma Rattus norvegicus
Q9NR50 0.000429 45 44 0 52 1 EIF2B3 Translation initiation factor eIF2B subunit gamma Homo sapiens
O93827 0.000552 44 23 11 280 1 MPG1 Mannose-1-phosphate guanyltransferase Candida albicans (strain SC5314 / ATCC MYA-2876)
A5PJI7 0.000566 45 42 0 52 2 EIF2B3 Translation initiation factor eIF2B subunit gamma Bos taurus
Q7JZB4 0.000668 44 25 6 187 1 Gmppb Mannose-1-phosphate guanylyltransferase catalytic subunit beta Drosophila melanogaster
Q86HG0 0.000752 44 25 9 230 2 gmppA Mannose-1-phosphate guanylyltransferase regulatory subunit alpha Dictyostelium discoideum
Q4R6T3 0.000868 44 44 0 52 2 EIF2B3 Translation initiation factor eIF2B subunit gamma Macaca fascicularis
Q7SXP8 0.001 44 24 9 233 2 gmppab Mannose-1-phosphate guanylyltransferase regulatory subunit alpha-B Danio rerio

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_11045
Feature type CDS
Gene galU
Product UTP--glucose-1-phosphate uridylyltransferase GalU
Location 99433 - 100338 (strand: 1)
Length 906 (nucleotides) / 301 (amino acids)

Contig

Accession ZDB_688
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_272
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00483 Nucleotidyl transferase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1210 Cell wall/membrane/envelope biogenesis (M) M UTP-glucose-1-phosphate uridylyltransferase

Kegg Ortholog Annotation(s)

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG013348 glucosephosphate uridylyltransferase VF0044 Immune modulation

Protein Sequence

MSVQKNKVHKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIILVTHSSKNSIENHFDTSFELEAILEKRVKRQLLDEVQSICPRHVTIMQTRQGIAKGLGHAVLCARPMIGDEPFAVVLPDVIIDEYSTDLAKFNLKEMIARYEEHGASQVMVDPVPQEMVANYGVVDCHGESLAAGESKPMFAVVEKPEPAKAPSNMSIVGRYVLSQDIWPLLGKTAPGAGDEIQLTDAIAMLIEKNPVEAYRLVGRSHDCGDKMGYMKAFVEYSMRHKHLGREFSDWLKTLQN

Flanking regions ( +/- flanking 50bp)

TTTTTTATAAATCGCGTATTTATTCTGTTTATGCGCATTGAGGATGATGTATGTCAGTGCAGAAAAATAAAGTACACAAGGCTGTGATCCCGGTTGCAGGATTAGGAACACGTATGCTGCCGGCCACAAAAGCGATTCCGAAAGAAATGCTGCCGCTGGTGGATAAACCGCTTATTCAGTATGTGGTGAATGAATGTATCGCGGCGGGGATCACTGAAATTATTTTAGTGACCCACTCATCAAAAAACTCCATTGAAAACCATTTCGATACCAGTTTTGAACTGGAAGCCATCCTGGAAAAACGTGTAAAACGTCAGTTGCTGGATGAAGTCCAGTCAATCTGCCCGCGTCACGTTACTATCATGCAGACCCGTCAGGGGATCGCCAAAGGGCTTGGTCACGCCGTATTATGCGCCAGACCAATGATTGGTGATGAGCCTTTTGCCGTGGTATTGCCGGATGTGATTATTGATGAATACAGCACTGACCTGGCGAAATTCAACCTGAAAGAAATGATTGCACGTTATGAAGAACACGGAGCAAGCCAGGTAATGGTCGATCCGGTTCCGCAGGAAATGGTGGCAAATTACGGCGTGGTGGATTGCCACGGTGAAAGCCTGGCCGCCGGTGAAAGCAAACCGATGTTTGCCGTGGTGGAAAAACCGGAACCGGCTAAAGCACCGTCGAATATGTCTATCGTCGGGCGTTATGTGCTTTCCCAGGATATCTGGCCGCTGCTGGGGAAAACTGCCCCGGGGGCCGGTGATGAGATCCAGCTGACTGACGCTATCGCCATGCTGATTGAAAAAAATCCGGTGGAGGCGTACCGTCTGGTAGGCCGCAGCCATGACTGCGGCGACAAAATGGGCTATATGAAAGCCTTTGTCGAGTACAGCATGCGTCATAAGCACCTGGGCCGTGAATTCTCAGACTGGCTGAAAACATTACAGAATTAATAATTGTTGCAATAGGTGAACTATGAAAGTAACCGTATTTGGAATCGGAT