Homologs in group_272

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05360 FBDBKF_05360 94.7 Morganella morganii S1 galU UTP--glucose-1-phosphate uridylyltransferase GalU
EHELCC_12230 EHELCC_12230 94.7 Morganella morganii S2 galU UTP--glucose-1-phosphate uridylyltransferase GalU
NLDBIP_12570 NLDBIP_12570 94.7 Morganella morganii S4 galU UTP--glucose-1-phosphate uridylyltransferase GalU
LHKJJB_12430 LHKJJB_12430 94.7 Morganella morganii S3 galU UTP--glucose-1-phosphate uridylyltransferase GalU
HKOGLL_11045 HKOGLL_11045 94.7 Morganella morganii S5 galU UTP--glucose-1-phosphate uridylyltransferase GalU
PMI_RS07215 PMI_RS07215 77.1 Proteus mirabilis HI4320 galU UTP--glucose-1-phosphate uridylyltransferase GalU
PMI_RS15355 PMI_RS15355 60.2 Proteus mirabilis HI4320 galU UTP--glucose-1-phosphate uridylyltransferase GalU

Distribution of the homologs in the orthogroup group_272

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_272

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEP6 2.71e-166 466 76 1 297 1 galU UTP--glucose-1-phosphate uridylyltransferase Shigella flexneri
P0AEP3 2.71e-166 466 76 1 297 1 galU UTP--glucose-1-phosphate uridylyltransferase Escherichia coli (strain K12)
P0AEP4 2.71e-166 466 76 1 297 3 galU UTP--glucose-1-phosphate uridylyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEP5 2.71e-166 466 76 1 297 3 galU UTP--glucose-1-phosphate uridylyltransferase Escherichia coli O157:H7
P44878 8.66e-149 422 69 0 290 3 galU UTP--glucose-1-phosphate uridylyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9F664 6.14e-142 404 65 0 290 3 galU UTP--glucose-1-phosphate uridylyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q48447 1.05e-114 335 57 2 291 3 galF UTP--glucose-1-phosphate uridylyltransferase Klebsiella pneumoniae
P0AAB6 1.99e-112 330 57 2 291 1 galF UTP--glucose-1-phosphate uridylyltransferase Escherichia coli (strain K12)
P0AAB7 1.99e-112 330 57 2 291 3 galF UTP--glucose-1-phosphate uridylyltransferase Escherichia coli O157:H7
P37776 1.62e-111 327 57 2 291 3 galF UTP--glucose-1-phosphate uridylyltransferase Shigella flexneri
P0A2K7 7.02e-110 323 54 2 291 3 galF UTP--glucose-1-phosphate uridylyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2K8 7.02e-110 323 54 2 291 3 galF UTP--glucose-1-phosphate uridylyltransferase Salmonella typhi
P0DG73 2.48e-81 251 44 4 294 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M3 (strain SSI-1)
P67070 2.48e-81 251 44 4 294 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0DG72 2.48e-81 251 44 4 294 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P67068 2.48e-81 251 44 4 294 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M1
Q5XE04 2.48e-81 251 44 4 294 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P58313 3.43e-81 250 46 4 294 3 cap4C UTP--glucose-1-phosphate uridylyltransferase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P0C0I9 3.23e-79 245 43 3 291 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M1
P0C0I8 3.33e-79 245 43 3 291 3 hasC UTP--glucose-1-phosphate uridylyltransferase Streptococcus pyogenes
Q8NKW9 3.33e-79 245 43 3 291 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q05852 3.82e-79 245 45 3 296 1 gtaB UTP--glucose-1-phosphate uridylyltransferase Bacillus subtilis (strain 168)
Q54800 4.18e-79 245 44 4 294 3 cap3C UTP--glucose-1-phosphate uridylyltransferase Streptococcus pneumoniae
Q5X9A7 4.93e-79 245 43 3 291 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DG71 4.93e-79 245 43 3 291 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DG70 4.93e-79 245 43 3 291 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q7A3J9 6.53e-79 244 43 3 294 1 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain N315)
Q99RD4 6.53e-79 244 43 3 294 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HD54 6.53e-79 244 43 3 294 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain COL)
Q2G1T6 6.53e-79 244 43 3 294 1 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FE05 6.53e-79 244 43 3 294 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain USA300)
Q8NUU9 9.54e-79 244 43 3 294 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain MW2)
Q6G6H5 9.54e-79 244 43 3 294 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain MSSA476)
Q49VP4 1.21e-78 243 43 3 295 3 gtaB2 UTP--glucose-1-phosphate uridylyltransferase 2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q6GDU6 1.46e-78 243 43 3 294 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain MRSA252)
Q2YW63 4.66e-78 242 43 3 294 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8CR67 3.87e-77 239 43 3 293 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLD1 3.87e-77 239 43 3 293 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4L8Y7 1.03e-76 238 43 3 294 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus haemolyticus (strain JCSC1435)
Q4A122 1.89e-75 235 43 5 297 3 gtaB1 UTP--glucose-1-phosphate uridylyltransferase 1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9I291 6.55e-73 228 45 5 275 1 galU UTP--glucose-1-phosphate uridylyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O31822 4.06e-72 227 44 4 295 1 yngB UTP--glucose-1-phosphate uridylyltransferase YngB Bacillus subtilis (strain 168)
P33696 2.25e-69 220 43 3 282 3 exoN UTP--glucose-1-phosphate uridylyltransferase Rhizobium meliloti (strain 1021)
Q59633 1.13e-67 215 43 4 270 3 galU UTP--glucose-1-phosphate uridylyltransferase Pseudomonas aeruginosa
Q58730 2.15e-66 212 41 6 292 3 MJ1334 Putative UTP--glucose-1-phosphate uridylyltransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P27897 7.2e-65 208 40 3 280 3 celA UTP--glucose-1-phosphate uridylyltransferase Komagataeibacter xylinus
P75124 4.16e-58 191 41 5 280 3 galU UTP--glucose-1-phosphate uridylyltransferase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47691 5.67e-58 191 38 4 285 3 galU UTP--glucose-1-phosphate uridylyltransferase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P42407 7.22e-47 161 38 7 269 3 ytdA Putative UTP--glucose-1-phosphate uridylyltransferase Bacillus subtilis (strain 168)
D4GU70 1.44e-20 93 26 8 265 3 agl11 Low-salt glycan biosynthesis nucleotidyltransferase Agl11 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
A6VG23 8.86e-19 89 29 8 259 3 MmarC7_0329 Bifunctional protein GlmU Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
D4GYH1 9.93e-19 86 27 7 262 1 aglF UTP--glucose-1-phosphate uridylyltransferase AglF Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
A4FX98 4.4e-17 84 28 8 259 3 MmarC5_0513 Bifunctional protein GlmU Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
A6UUQ4 5.98e-17 84 28 7 261 3 Maeo_0642 Bifunctional protein GlmU Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Q58501 2.92e-15 79 28 8 259 1 glmU Bifunctional protein GlmU Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P39629 2.43e-14 74 23 7 261 1 rmlA Glucose-1-phosphate thymidylyltransferase Bacillus subtilis (strain 168)
A6UP85 2.6e-14 76 28 10 264 3 Mevan_0399 Bifunctional protein GlmU Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q6LYB5 2.26e-13 73 29 9 260 3 MMP1076 Bifunctional protein GlmU Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
P37779 1.59e-12 70 25 9 276 3 rfbA Glucose-1-phosphate thymidylyltransferase 1 Shigella flexneri
P37744 1.7e-12 70 25 9 276 1 rfbA Glucose-1-phosphate thymidylyltransferase 1 Escherichia coli (strain K12)
P55254 5.72e-12 68 25 9 276 3 rmlA Glucose-1-phosphate thymidylyltransferase Salmonella anatum
P55253 1.36e-11 67 25 10 277 1 rmlA Glucose-1-phosphate thymidylyltransferase Escherichia coli
P26393 1.69e-11 67 25 9 276 1 rmlA Glucose-1-phosphate thymidylyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q975F9 2.71e-11 67 28 10 263 1 STK_04520 Bifunctional sugar-1-phosphate nucleotidylyltransferase/acetyltransferase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
P55255 6.07e-11 65 26 11 259 3 rmlA1 Glucose-1-phosphate thymidylyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9RR29 1.16e-10 65 24 6 262 3 oleS Glucose-1-phosphate thymidylyltransferase Streptomyces antibioticus
Q9L9E6 1.25e-10 64 23 7 238 3 novV Glucose-1-phosphate thymidylyltransferase Streptomyces niveus
P55257 1.56e-10 64 25 11 256 3 rmlA Glucose-1-phosphate thymidylyltransferase Yersinia enterocolitica
P57040 1.58e-10 64 25 11 258 3 rmlA1 Glucose-1-phosphate thymidylyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P0C7J4 2.47e-10 63 25 7 238 3 rmlA Glucose-1-phosphate thymidylyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RVK9 2.47e-10 63 25 7 238 3 rmlA Glucose-1-phosphate thymidylyltransferase Xanthomonas campestris pv. campestris (strain B100)
A2VD83 3.1e-10 63 24 10 288 2 gmppb-b Mannose-1-phosphate guanyltransferase beta-B Xenopus laevis
P08075 4.37e-10 63 24 8 262 3 strD Glucose-1-phosphate thymidylyltransferase Streptomyces griseus
Q9ZAE7 1.25e-09 61 22 9 280 3 acbA Glucose-1-phosphate thymidylyltransferase Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110)
P95778 1.55e-09 61 25 8 236 3 rmlA Glucose-1-phosphate thymidylyltransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q68EY9 5.35e-09 60 24 11 297 2 gmppb-a Mannose-1-phosphate guanyltransferase beta-A Xenopus laevis
P61888 1.46e-08 58 24 11 258 3 rffH Glucose-1-phosphate thymidylyltransferase 2 Shigella flexneri
P61887 1.46e-08 58 24 11 258 1 rffH Glucose-1-phosphate thymidylyltransferase 2 Escherichia coli (strain K12)
P74285 1.47e-08 58 24 6 218 1 cugP UTP--glucose-1-phosphate uridylyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q68EQ1 1.82e-08 58 23 11 297 2 gmppb Mannose-1-phosphate guanylyltransferase catalytic subunit beta Xenopus tropicalis
Q88QT2 2.14e-08 57 28 1 132 1 murU N-acetylmuramate alpha-1-phosphate uridylyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P37762 3.8e-08 57 23 10 256 3 rmlA Glucose-1-phosphate thymidylyltransferase Neisseria gonorrhoeae
Q8BTZ7 4.27e-08 57 25 12 293 1 Gmppb Mannose-1-phosphate guanylyltransferase catalytic subunit beta Mus musculus
Q2YDJ9 4.99e-08 57 26 12 284 2 GMPPB Mannose-1-phosphate guanylyltransferase catalytic subunit beta Bos taurus
Q6DBU5 6.86e-08 56 24 8 274 1 gmppb Mannose-1-phosphate guanylyltransferase catalytic subunit beta Danio rerio
P0C5I2 8.39e-08 56 27 10 230 1 GMPPB Mannose-1-phosphate guanylyltransferase catalytic subunit beta Sus scrofa
P9WH13 1.73e-07 55 26 8 217 1 rmlA Glucose-1-phosphate thymidylyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WH12 1.73e-07 55 26 8 217 3 rmlA Glucose-1-phosphate thymidylyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q1DC47 1.97e-07 55 23 10 262 3 glgC Glucose-1-phosphate adenylyltransferase Myxococcus xanthus (strain DK1622)
Q9Y5P6 2.69e-07 55 27 10 230 1 GMPPB Mannose-1-phosphate guanylyltransferase catalytic subunit beta Homo sapiens
A0QPF9 2.99e-07 54 25 8 230 1 rmlA Glucose-1-phosphate thymidylyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9JXY0 5.05e-07 53 31 4 137 3 murU N-acetylmuramate alpha-1-phosphate uridylyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A7H6H5 9.74e-07 53 22 10 257 3 glgC Glucose-1-phosphate adenylyltransferase Anaeromyxobacter sp. (strain Fw109-5)
Q0P8J1 2.53e-06 50 35 0 67 1 hddC D-glycero-alpha-D-manno-heptose 1-phosphate guanylyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q295Y7 2.65e-06 52 23 11 280 3 GA10892 Mannose-1-phosphate guanylyltransferase catalytic subunit beta Drosophila pseudoobscura pseudoobscura
A9FSV7 3.55e-06 51 30 4 116 3 glmU Bifunctional protein GlmU Sorangium cellulosum (strain So ce56)
Q4I1Y5 6.61e-06 50 23 8 276 3 MPG1 Mannose-1-phosphate guanyltransferase Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
O22287 9.26e-06 50 27 7 178 1 CYT1 Mannose-1-phosphate guanylyltransferase 1 Arabidopsis thaliana
Q0VFM6 9.51e-06 50 25 8 242 2 gmppa Mannose-1-phosphate guanylyltransferase regulatory subunit alpha Xenopus tropicalis
O06486 1.06e-05 49 23 8 257 3 yfnH Probable glucose-1-phosphate cytidylyltransferase Bacillus subtilis (strain 168)
Q87HX3 1.17e-05 50 21 12 293 3 glgC2 Glucose-1-phosphate adenylyltransferase 2 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8DPI6 1.84e-05 48 43 0 51 1 licC Choline-phosphate cytidylyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q6CCU3 2.04e-05 49 27 9 221 3 MPG1 Mannose-1-phosphate guanyltransferase Yarrowia lipolytica (strain CLIB 122 / E 150)
B9CM12 2.67e-05 48 43 0 51 1 pntC 2-aminoethylphosphonate cytidylyltransferase Lancefieldella rimae (strain ATCC 49626 / DSM 7090 / CCUG 31168 / NBRC 15546 / VPI D140H-11A)
O74624 2.78e-05 48 22 10 273 1 mpg1 Mannose-1-phosphate guanyltransferase Hypocrea jecorina
O74484 3.23e-05 48 25 12 281 2 mpg1 Mannose-1-phosphate guanyltransferase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q7JZB4 3.95e-05 48 22 11 280 1 Gmppb Mannose-1-phosphate guanylyltransferase catalytic subunit beta Drosophila melanogaster
Q66KG5 4.41e-05 48 24 8 245 2 gmppa-b Mannose-1-phosphate guanyltransferase alpha-B Xenopus laevis
B4ULA3 4.95e-05 48 21 9 237 3 glgC Glucose-1-phosphate adenylyltransferase Anaeromyxobacter sp. (strain K)
Q5B1J4 5.55e-05 47 25 7 224 3 mpg1 Mannose-1-phosphate guanyltransferase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
B8J7Y5 5.57e-05 47 21 9 237 3 glgC Glucose-1-phosphate adenylyltransferase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q9AGY6 6.13e-05 47 32 0 67 1 hddC D-glycero-alpha-D-manno-heptose 1-phosphate guanylyltransferase Aneurinibacillus thermoaerophilus
Q84JH5 6.15e-05 47 24 8 220 2 Os03g0268400 Probable mannose-1-phosphate guanylyltransferase 1 Oryza sativa subsp. japonica
Q6Z9A3 7.17e-05 47 25 6 177 2 Os08g0237200 Probable mannose-1-phosphate guanylyltransferase 3 Oryza sativa subsp. japonica
B9DRS6 7.35e-05 47 23 11 298 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
P55464 7.6e-05 47 40 0 52 3 rmlA Probable glucose-1-phosphate thymidylyltransferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B2IPY6 8.05e-05 47 23 10 281 3 glgC Glucose-1-phosphate adenylyltransferase Streptococcus pneumoniae (strain CGSP14)
Q9M2S0 8.33e-05 47 25 6 177 2 At3g55590 Probable mannose-1-phosphate guanylyltransferase 2 Arabidopsis thaliana
Q9KLP4 8.34e-05 47 24 14 291 3 glgC2 Glucose-1-phosphate adenylyltransferase 2 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P32501 0.000102 47 33 0 66 1 GCD6 Translation initiation factor eIF2B subunit epsilon Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q752H4 0.000131 46 22 12 286 3 MPG1 Mannose-1-phosphate guanyltransferase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q70SJ2 0.000136 46 22 11 276 1 MPG1 Mannose-1-phosphate guanyltransferase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q6DKE9 0.000179 46 25 8 224 2 gmppa-a Mannose-1-phosphate guanyltransferase alpha-A Xenopus laevis
Q54K39 0.000184 46 24 8 218 2 gmppB Mannose-1-phosphate guanylyltransferase catalytic subunit beta Dictyostelium discoideum
Q7SXP8 0.000197 46 24 10 233 2 gmppab Mannose-1-phosphate guanylyltransferase regulatory subunit alpha-B Danio rerio
Q2UJU5 0.000203 46 26 3 146 3 mpg1 Mannose-1-phosphate guanyltransferase Aspergillus oryzae (strain ATCC 42149 / RIB 40)
L7N6A5 0.000214 45 35 0 73 1 manB Mannose-1-phosphate guanylyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q4U3E8 0.000214 46 39 0 53 2 mpg1 Mannose-1-phosphate guanyltransferase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q8Z5I4 0.000257 45 21 5 226 1 rfbF Glucose-1-phosphate cytidylyltransferase Salmonella typhi
Q0P8J8 0.000287 45 34 0 63 1 Cj1416c CTP:phosphoglutamine cytidylyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
O93827 0.000294 45 23 11 282 1 MPG1 Mannose-1-phosphate guanyltransferase Candida albicans (strain SC5314 / ATCC MYA-2876)
P26396 0.000309 45 21 5 226 3 rfbF Glucose-1-phosphate cytidylyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q941T9 0.000368 45 24 6 177 2 Os01g0847200 Probable mannose-1-phosphate guanylyltransferase 2 Oryza sativa subsp. japonica
P70541 0.000403 45 44 0 52 2 Eif2b3 Translation initiation factor eIF2B subunit gamma Rattus norvegicus
Q9NR50 0.000469 45 44 0 52 1 EIF2B3 Translation initiation factor eIF2B subunit gamma Homo sapiens
B1YGP5 0.000606 44 25 6 175 3 glmU Bifunctional protein GlmU Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A5PJI7 0.000608 44 42 0 52 2 EIF2B3 Translation initiation factor eIF2B subunit gamma Bos taurus
A0JWV0 0.000783 44 22 9 229 3 glgC Glucose-1-phosphate adenylyltransferase Arthrobacter sp. (strain FB24)
Q4R6T3 0.001 44 44 0 52 2 EIF2B3 Translation initiation factor eIF2B subunit gamma Macaca fascicularis

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05815
Feature type CDS
Gene galU
Product UTP--glucose-1-phosphate uridylyltransferase GalU
Location 1238065 - 1238970 (strand: -1)
Length 906 (nucleotides) / 301 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_272
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00483 Nucleotidyl transferase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1210 Cell wall/membrane/envelope biogenesis (M) M UTP-glucose-1-phosphate uridylyltransferase

Kegg Ortholog Annotation(s)

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG013348 glucosephosphate uridylyltransferase VF0044 Immune modulation

Protein Sequence

MSALKNKVHKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIILVTHSSKNSIENHFDTSFELEAILEKRVKRQLLDEVQSICPRHVTIMQTRQGIAKGLGHAVLCARPMIGDEPFAVVLPDVVIDEYSTDLSKFNLKEMIQRYEDNQASQVMVEPVPLEVVSNYGVVDCHGENLAAGESKPMFAVVEKPEPAKAPSNMSIVGRYVLSPDIWSLLGKTAPGAGDEIQLTDAIAMLIEKNPVEAYRLVGRSHDCGDKMGYMKAFVEYSMRHKHLGGEFSDWLKTLQN

Flanking regions ( +/- flanking 50bp)

TTTTGTATTAATCGCGTATTGGTTTTGTATATACGCATTGAGGATGATGTATGTCAGCGCTGAAAAATAAGGTTCATAAGGCCGTGATCCCGGTTGCAGGATTAGGAACACGTATGCTTCCGGCCACCAAAGCAATTCCGAAAGAAATGTTACCGCTGGTGGACAAACCACTTATCCAGTATGTCGTTAATGAATGTATCGCCGCAGGGATCACTGAAATTATTTTAGTGACCCACTCCTCAAAAAACTCCATTGAAAACCATTTTGATACCAGTTTTGAACTGGAAGCCATTCTGGAAAAACGCGTTAAGCGCCAGTTACTCGATGAAGTTCAGTCAATCTGTCCCCGCCATGTCACTATTATGCAGACCCGCCAGGGTATTGCGAAAGGGCTGGGACACGCCGTGTTATGTGCCCGCCCGATGATTGGTGATGAGCCGTTTGCCGTTGTACTGCCGGACGTGGTTATCGATGAATACAGCACTGACCTGTCAAAATTTAATCTTAAAGAGATGATCCAGCGCTATGAAGATAATCAGGCAAGCCAGGTGATGGTCGAACCTGTGCCGCTTGAAGTTGTCTCAAACTATGGAGTGGTGGACTGTCATGGTGAAAACCTGGCAGCCGGCGAAAGCAAACCGATGTTTGCCGTGGTGGAAAAACCGGAACCGGCTAAAGCACCGTCGAATATGTCTATTGTCGGGCGCTATGTGTTATCTCCGGATATCTGGTCGCTGCTGGGTAAAACAGCGCCAGGCGCCGGGGATGAAATCCAGTTAACAGATGCCATCGCCATGCTGATTGAGAAAAACCCCGTTGAAGCTTACCGCCTGGTCGGACGCAGTCACGATTGCGGCGACAAAATGGGGTATATGAAAGCGTTTGTCGAATACAGCATGCGCCATAAACATCTGGGTGGTGAATTCTCAGATTGGCTGAAAACATTACAGAATTAATTATTGTCGCTATAGGTGAACTATGAAAGTAACTGTATTTGGAATCGGAT