Homologs in group_272

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05360 FBDBKF_05360 77.4 Morganella morganii S1 galU UTP--glucose-1-phosphate uridylyltransferase GalU
EHELCC_12230 EHELCC_12230 77.4 Morganella morganii S2 galU UTP--glucose-1-phosphate uridylyltransferase GalU
NLDBIP_12570 NLDBIP_12570 77.4 Morganella morganii S4 galU UTP--glucose-1-phosphate uridylyltransferase GalU
LHKJJB_12430 LHKJJB_12430 77.4 Morganella morganii S3 galU UTP--glucose-1-phosphate uridylyltransferase GalU
HKOGLL_11045 HKOGLL_11045 77.4 Morganella morganii S5 galU UTP--glucose-1-phosphate uridylyltransferase GalU
F4V73_RS05815 F4V73_RS05815 77.1 Morganella psychrotolerans galU UTP--glucose-1-phosphate uridylyltransferase GalU
PMI_RS15355 PMI_RS15355 63.6 Proteus mirabilis HI4320 galU UTP--glucose-1-phosphate uridylyltransferase GalU

Distribution of the homologs in the orthogroup group_272

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_272

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEP6 4.67e-169 473 76 1 297 1 galU UTP--glucose-1-phosphate uridylyltransferase Shigella flexneri
P0AEP3 4.67e-169 473 76 1 297 1 galU UTP--glucose-1-phosphate uridylyltransferase Escherichia coli (strain K12)
P0AEP4 4.67e-169 473 76 1 297 3 galU UTP--glucose-1-phosphate uridylyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEP5 4.67e-169 473 76 1 297 3 galU UTP--glucose-1-phosphate uridylyltransferase Escherichia coli O157:H7
P44878 1.14e-152 431 70 0 290 3 galU UTP--glucose-1-phosphate uridylyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9F664 4.52e-145 412 66 0 290 3 galU UTP--glucose-1-phosphate uridylyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q48447 9.58e-115 335 56 2 293 3 galF UTP--glucose-1-phosphate uridylyltransferase Klebsiella pneumoniae
P0AAB6 3.67e-114 334 56 2 291 1 galF UTP--glucose-1-phosphate uridylyltransferase Escherichia coli (strain K12)
P0AAB7 3.67e-114 334 56 2 291 3 galF UTP--glucose-1-phosphate uridylyltransferase Escherichia coli O157:H7
P37776 2.98e-113 332 56 2 291 3 galF UTP--glucose-1-phosphate uridylyltransferase Shigella flexneri
P0A2K7 7.73e-112 328 56 2 291 3 galF UTP--glucose-1-phosphate uridylyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2K8 7.73e-112 328 56 2 291 3 galF UTP--glucose-1-phosphate uridylyltransferase Salmonella typhi
Q49VP4 2.61e-85 260 46 3 296 3 gtaB2 UTP--glucose-1-phosphate uridylyltransferase 2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q7A3J9 2.04e-84 258 45 4 295 1 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain N315)
Q99RD4 2.04e-84 258 45 4 295 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HD54 2.04e-84 258 45 4 295 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain COL)
Q2G1T6 2.04e-84 258 45 4 295 1 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FE05 2.04e-84 258 45 4 295 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain USA300)
Q8CR67 2.25e-84 258 45 3 295 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLD1 2.25e-84 258 45 3 295 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8NUU9 2.89e-84 258 45 4 295 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain MW2)
Q6G6H5 2.89e-84 258 45 4 295 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain MSSA476)
Q6GDU6 4.82e-84 257 45 4 295 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain MRSA252)
Q2YW63 1.72e-83 256 45 4 295 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q05852 1.74e-83 256 46 3 295 1 gtaB UTP--glucose-1-phosphate uridylyltransferase Bacillus subtilis (strain 168)
Q4L8Y7 1.99e-82 253 45 3 295 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus haemolyticus (strain JCSC1435)
P58313 5.65e-82 252 46 4 297 3 cap4C UTP--glucose-1-phosphate uridylyltransferase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P0C0I8 9.78e-82 252 44 3 293 3 hasC UTP--glucose-1-phosphate uridylyltransferase Streptococcus pyogenes
Q8NKW9 9.78e-82 252 44 3 293 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9A7 1.18e-81 251 44 3 293 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DG71 1.18e-81 251 44 3 293 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DG70 1.18e-81 251 44 3 293 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0C0I9 1.3e-81 251 44 3 293 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M1
P0DG73 1.99e-81 251 44 3 293 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M3 (strain SSI-1)
P67070 1.99e-81 251 44 3 293 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0DG72 1.99e-81 251 44 3 293 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P67068 1.99e-81 251 44 3 293 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M1
Q5XE04 1.99e-81 251 44 3 293 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q54800 1.63e-80 249 45 4 296 3 cap3C UTP--glucose-1-phosphate uridylyltransferase Streptococcus pneumoniae
Q4A122 3.79e-79 244 45 4 293 3 gtaB1 UTP--glucose-1-phosphate uridylyltransferase 1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
O31822 1.15e-77 241 44 3 294 1 yngB UTP--glucose-1-phosphate uridylyltransferase YngB Bacillus subtilis (strain 168)
Q9I291 1.3e-74 233 46 4 270 1 galU UTP--glucose-1-phosphate uridylyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q58730 4.57e-74 231 45 6 293 3 MJ1334 Putative UTP--glucose-1-phosphate uridylyltransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P33696 5.57e-74 232 43 4 286 3 exoN UTP--glucose-1-phosphate uridylyltransferase Rhizobium meliloti (strain 1021)
Q59633 1.89e-67 214 42 4 270 3 galU UTP--glucose-1-phosphate uridylyltransferase Pseudomonas aeruginosa
P27897 3.97e-66 211 40 2 273 3 celA UTP--glucose-1-phosphate uridylyltransferase Komagataeibacter xylinus
P75124 4.46e-61 198 44 6 274 3 galU UTP--glucose-1-phosphate uridylyltransferase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47691 4.98e-58 191 39 4 286 3 galU UTP--glucose-1-phosphate uridylyltransferase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P42407 1.5e-47 163 38 7 269 3 ytdA Putative UTP--glucose-1-phosphate uridylyltransferase Bacillus subtilis (strain 168)
D4GU70 5.89e-23 100 29 8 264 3 agl11 Low-salt glycan biosynthesis nucleotidyltransferase Agl11 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
A6VG23 3e-22 99 30 8 259 3 MmarC7_0329 Bifunctional protein GlmU Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
D4GYH1 5.91e-20 90 29 8 261 1 aglF UTP--glucose-1-phosphate uridylyltransferase AglF Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
A4FX98 7.88e-20 92 28 7 259 3 MmarC5_0513 Bifunctional protein GlmU Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Q6LYB5 4.36e-17 84 30 8 260 3 MMP1076 Bifunctional protein GlmU Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
P39629 3.52e-16 79 26 7 262 1 rmlA Glucose-1-phosphate thymidylyltransferase Bacillus subtilis (strain 168)
Q58501 4.14e-16 81 29 8 267 1 glmU Bifunctional protein GlmU Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A6UP85 6.78e-16 80 28 10 264 3 Mevan_0399 Bifunctional protein GlmU Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
A6UUQ4 1.79e-15 79 27 6 259 3 Maeo_0642 Bifunctional protein GlmU Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
P37779 4.3e-13 71 25 8 239 3 rfbA Glucose-1-phosphate thymidylyltransferase 1 Shigella flexneri
P55254 1.67e-12 70 25 8 247 3 rmlA Glucose-1-phosphate thymidylyltransferase Salmonella anatum
P37744 1.85e-12 69 24 7 247 1 rfbA Glucose-1-phosphate thymidylyltransferase 1 Escherichia coli (strain K12)
Q975F9 5.47e-12 69 28 10 263 1 STK_04520 Bifunctional sugar-1-phosphate nucleotidylyltransferase/acetyltransferase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
P26393 5.56e-12 68 25 8 247 1 rmlA Glucose-1-phosphate thymidylyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P55253 3.13e-11 66 25 9 248 1 rmlA Glucose-1-phosphate thymidylyltransferase Escherichia coli
P55255 3.31e-11 66 24 10 243 3 rmlA1 Glucose-1-phosphate thymidylyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P57040 1.01e-10 64 23 10 243 3 rmlA1 Glucose-1-phosphate thymidylyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P74285 2.33e-10 64 28 7 213 1 cugP UTP--glucose-1-phosphate uridylyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P08075 2.44e-10 63 24 9 262 3 strD Glucose-1-phosphate thymidylyltransferase Streptomyces griseus
P0C7J4 2.71e-10 63 24 8 239 3 rmlA Glucose-1-phosphate thymidylyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RVK9 2.71e-10 63 24 8 239 3 rmlA Glucose-1-phosphate thymidylyltransferase Xanthomonas campestris pv. campestris (strain B100)
Q9RR29 5.53e-10 63 24 8 264 3 oleS Glucose-1-phosphate thymidylyltransferase Streptomyces antibioticus
P95778 1.34e-09 61 26 11 236 3 rmlA Glucose-1-phosphate thymidylyltransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q6DBU5 1.49e-09 61 26 11 280 1 gmppb Mannose-1-phosphate guanylyltransferase catalytic subunit beta Danio rerio
Q9L9E6 1.78e-09 61 22 6 235 3 novV Glucose-1-phosphate thymidylyltransferase Streptomyces niveus
P0C5I2 4.37e-09 60 31 10 217 1 GMPPB Mannose-1-phosphate guanylyltransferase catalytic subunit beta Sus scrofa
Q1DC47 9.21e-09 59 24 10 262 3 glgC Glucose-1-phosphate adenylyltransferase Myxococcus xanthus (strain DK1622)
Q9Y5P6 1.07e-08 59 27 12 281 1 GMPPB Mannose-1-phosphate guanylyltransferase catalytic subunit beta Homo sapiens
A2VD83 1.15e-08 58 26 10 280 2 gmppb-b Mannose-1-phosphate guanyltransferase beta-B Xenopus laevis
Q8BTZ7 1.35e-08 58 30 10 217 1 Gmppb Mannose-1-phosphate guanylyltransferase catalytic subunit beta Mus musculus
Q2YDJ9 1.56e-08 58 30 10 220 2 GMPPB Mannose-1-phosphate guanylyltransferase catalytic subunit beta Bos taurus
Q88QT2 1.72e-08 57 30 1 138 1 murU N-acetylmuramate alpha-1-phosphate uridylyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q68EY9 2.63e-08 58 26 10 280 2 gmppb-a Mannose-1-phosphate guanyltransferase beta-A Xenopus laevis
P55257 3.23e-08 57 23 9 244 3 rmlA Glucose-1-phosphate thymidylyltransferase Yersinia enterocolitica
Q68EQ1 3.25e-08 57 26 11 281 2 gmppb Mannose-1-phosphate guanylyltransferase catalytic subunit beta Xenopus tropicalis
Q4I1Y5 3.34e-08 57 25 10 279 3 MPG1 Mannose-1-phosphate guanyltransferase Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q6CCU3 4.81e-08 57 26 12 276 3 MPG1 Mannose-1-phosphate guanyltransferase Yarrowia lipolytica (strain CLIB 122 / E 150)
A0QPF9 4.83e-08 56 24 7 236 1 rmlA Glucose-1-phosphate thymidylyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9ZAE7 4.91e-08 57 20 8 281 3 acbA Glucose-1-phosphate thymidylyltransferase Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110)
P37762 6.26e-08 56 23 10 243 3 rmlA Glucose-1-phosphate thymidylyltransferase Neisseria gonorrhoeae
P61888 7.82e-08 56 23 7 246 3 rffH Glucose-1-phosphate thymidylyltransferase 2 Shigella flexneri
P61887 7.82e-08 56 23 7 246 1 rffH Glucose-1-phosphate thymidylyltransferase 2 Escherichia coli (strain K12)
Q54K39 2.41e-07 55 27 6 198 2 gmppB Mannose-1-phosphate guanylyltransferase catalytic subunit beta Dictyostelium discoideum
O22287 3.07e-07 54 29 8 202 1 CYT1 Mannose-1-phosphate guanylyltransferase 1 Arabidopsis thaliana
O06486 5.5e-07 53 26 4 175 3 yfnH Probable glucose-1-phosphate cytidylyltransferase Bacillus subtilis (strain 168)
Q9M2S0 6.16e-07 53 28 7 198 2 At3g55590 Probable mannose-1-phosphate guanylyltransferase 2 Arabidopsis thaliana
P9WH13 6.35e-07 53 26 8 218 1 rmlA Glucose-1-phosphate thymidylyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WH12 6.35e-07 53 26 8 218 3 rmlA Glucose-1-phosphate thymidylyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O74484 9.42e-07 53 27 12 274 2 mpg1 Mannose-1-phosphate guanyltransferase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B2GHR6 1.4e-06 52 23 8 224 3 glgC Glucose-1-phosphate adenylyltransferase Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
Q9JXY0 1.63e-06 51 29 7 181 3 murU N-acetylmuramate alpha-1-phosphate uridylyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q8DPI6 2.8e-06 50 45 0 51 1 licC Choline-phosphate cytidylyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q66KG5 2.89e-06 52 26 10 248 2 gmppa-b Mannose-1-phosphate guanyltransferase alpha-B Xenopus laevis
Q0P8J1 3.55e-06 50 34 0 67 1 hddC D-glycero-alpha-D-manno-heptose 1-phosphate guanylyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q84JH5 5.19e-06 50 27 7 197 2 Os03g0268400 Probable mannose-1-phosphate guanylyltransferase 1 Oryza sativa subsp. japonica
B9CM12 6.25e-06 50 45 0 51 1 pntC 2-aminoethylphosphonate cytidylyltransferase Lancefieldella rimae (strain ATCC 49626 / DSM 7090 / CCUG 31168 / NBRC 15546 / VPI D140H-11A)
B9L1J9 6.46e-06 50 21 7 270 3 glgC Glucose-1-phosphate adenylyltransferase Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
A9FSV7 1.01e-05 50 28 5 132 3 glmU Bifunctional protein GlmU Sorangium cellulosum (strain So ce56)
O74624 1.03e-05 50 26 11 274 1 mpg1 Mannose-1-phosphate guanyltransferase Hypocrea jecorina
Q0VFM6 2.25e-05 49 26 10 243 2 gmppa Mannose-1-phosphate guanylyltransferase regulatory subunit alpha Xenopus tropicalis
B1YGP5 2.28e-05 49 25 7 195 3 glmU Bifunctional protein GlmU Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A7H6H5 2.52e-05 48 22 13 294 3 glgC Glucose-1-phosphate adenylyltransferase Anaeromyxobacter sp. (strain Fw109-5)
P55464 2.57e-05 48 42 0 52 3 rmlA Probable glucose-1-phosphate thymidylyltransferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q70SJ2 2.73e-05 48 24 11 274 1 MPG1 Mannose-1-phosphate guanyltransferase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q5N3K9 2.78e-05 48 23 6 201 3 glgC Glucose-1-phosphate adenylyltransferase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31QN4 2.78e-05 48 23 6 201 3 glgC Glucose-1-phosphate adenylyltransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q9AGY6 3e-05 47 31 0 67 1 hddC D-glycero-alpha-D-manno-heptose 1-phosphate guanylyltransferase Aneurinibacillus thermoaerophilus
O93827 3.02e-05 48 24 10 272 1 MPG1 Mannose-1-phosphate guanyltransferase Candida albicans (strain SC5314 / ATCC MYA-2876)
Q0P8J8 3.95e-05 47 36 0 63 1 Cj1416c CTP:phosphoglutamine cytidylyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q6DKE9 4.04e-05 48 26 10 232 2 gmppa-a Mannose-1-phosphate guanyltransferase alpha-A Xenopus laevis
Q2UJU5 4.6e-05 48 26 8 219 3 mpg1 Mannose-1-phosphate guanyltransferase Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q8RF63 4.73e-05 48 23 12 284 3 glgC Glucose-1-phosphate adenylyltransferase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q5B1J4 5.76e-05 47 28 9 217 3 mpg1 Mannose-1-phosphate guanyltransferase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q752H4 6.04e-05 47 25 12 275 3 MPG1 Mannose-1-phosphate guanyltransferase Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q8Z5I4 6.11e-05 47 22 8 256 1 rfbF Glucose-1-phosphate cytidylyltransferase Salmonella typhi
A3QMC8 6.2e-05 47 25 6 217 3 tag-335 Mannose-1-phosphate guanylyltransferase catalytic subunit beta Caenorhabditis elegans
Q9KLP4 7.09e-05 47 23 14 294 3 glgC2 Glucose-1-phosphate adenylyltransferase 2 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q4U3E8 7.34e-05 47 26 8 219 2 mpg1 Mannose-1-phosphate guanyltransferase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q6Z9A3 7.84e-05 47 27 7 200 2 Os08g0237200 Probable mannose-1-phosphate guanylyltransferase 3 Oryza sativa subsp. japonica
Q87HX3 9.84e-05 47 20 12 294 3 glgC2 Glucose-1-phosphate adenylyltransferase 2 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B5YHS4 0.000126 47 27 12 257 3 glmU Bifunctional protein GlmU Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q941T9 0.000136 46 27 7 200 2 Os01g0847200 Probable mannose-1-phosphate guanylyltransferase 2 Oryza sativa subsp. japonica
P32501 0.00019 46 31 0 66 1 GCD6 Translation initiation factor eIF2B subunit epsilon Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P26396 0.000194 45 22 8 256 3 rfbF Glucose-1-phosphate cytidylyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P70541 0.000208 46 44 0 52 2 Eif2b3 Translation initiation factor eIF2B subunit gamma Rattus norvegicus
L7N6A5 0.000228 45 31 0 88 1 manB Mannose-1-phosphate guanylyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q9NR50 0.00024 46 44 0 52 1 EIF2B3 Translation initiation factor eIF2B subunit gamma Homo sapiens
Q9A2M1 0.000288 45 35 0 62 3 murU N-acetylmuramate alpha-1-phosphate uridylyltransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9RW61 0.000327 45 25 12 224 3 glmU Bifunctional protein GlmU Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A5PJI7 0.000334 45 42 0 52 2 EIF2B3 Translation initiation factor eIF2B subunit gamma Bos taurus
C4KZV1 0.000481 45 25 11 257 3 glmU Bifunctional protein GlmU Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q5XIC1 0.000624 44 25 10 266 2 Gmppa Mannose-1-phosphate guanylyltransferase regulatory subunit alpha Rattus norvegicus
Q4R6T3 0.000816 44 42 0 52 2 EIF2B3 Translation initiation factor eIF2B subunit gamma Macaca fascicularis
Q6FRY2 0.001 43 24 12 267 3 MPG1 Mannose-1-phosphate guanyltransferase 2 Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS07215
Feature type CDS
Gene galU
Product UTP--glucose-1-phosphate uridylyltransferase GalU
Location 1580586 - 1581491 (strand: -1)
Length 906 (nucleotides) / 301 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_272
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00483 Nucleotidyl transferase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1210 Cell wall/membrane/envelope biogenesis (M) M UTP-glucose-1-phosphate uridylyltransferase

Kegg Ortholog Annotation(s)

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG013348 glucosephosphate uridylyltransferase VF0044 Immune modulation

Protein Sequence

MSSVVRKVRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVNECIAAGINEIVLVTHSSKNSIENHFDTSFELEAILEKRVKRQLLEEVQGICPSHVTIMQTRQGIAKGLGHAILCAKPLVGDEPFAVILPDVILDRYSADLTKVNLKEMLSHFEQSGASQILVEPVPEEEVSNYGIVDCMGEHLQPGDSKPITRVVEKPKKEEAPSNLSIVGRYVLSENIWPLLAKTAPGAGDEIQLTDAIAMLIEKEPVEAYHLQGKSHDCGNKLGYMKAFVEYGLQHEEFGEEFTKWIKSLQA

Flanking regions ( +/- flanking 50bp)

ACCATAACATCATAGGAATATCATGGTACTTAATTTGTAGGAGAAGAGTAATGTCATCAGTGGTGCGTAAAGTAAGAAAAGCGGTGATCCCTGTTGCAGGGCTAGGAACAAGAATGTTGCCTGCCACCAAGGCTATCCCAAAAGAGATGCTACCTGTTGTTGATAAACCTTTAATTCAATATGTTGTTAATGAATGTATTGCAGCTGGCATCAATGAAATTGTGCTAGTTACACACTCTTCAAAAAATTCTATTGAAAACCATTTTGATACCAGTTTTGAATTAGAAGCTATTTTAGAAAAACGAGTTAAACGTCAGTTGTTGGAAGAAGTACAAGGTATTTGTCCAAGTCACGTTACTATTATGCAAACTCGCCAAGGAATAGCAAAAGGGTTAGGCCATGCCATTTTATGTGCAAAACCTTTGGTGGGTGATGAGCCTTTCGCTGTTATCTTGCCGGATGTTATTTTAGACCGATATAGTGCTGATCTGACTAAGGTTAATTTAAAAGAGATGCTTTCTCATTTTGAACAATCTGGCGCAAGTCAAATTTTAGTAGAGCCTGTTCCTGAAGAGGAAGTATCTAACTACGGGATTGTTGACTGCATGGGAGAACATTTACAGCCTGGCGACAGTAAACCCATTACTCGTGTGGTAGAAAAACCGAAGAAAGAAGAAGCACCTTCAAATTTATCTATTGTTGGTCGTTATGTGTTGTCTGAAAACATTTGGCCTTTATTAGCCAAAACGGCACCAGGAGCAGGGGATGAAATTCAATTAACTGACGCGATTGCAATGTTAATTGAAAAAGAGCCTGTAGAAGCTTATCACCTACAAGGGAAAAGCCACGATTGTGGTAATAAATTAGGTTATATGAAAGCTTTTGTTGAATATGGTTTACAGCACGAAGAGTTTGGCGAAGAGTTCACGAAATGGATAAAATCACTGCAAGCTTAATGTGTTGAGTAACAAAATTTAACGATTTATCTTGTTAATAGTGTCGCACT