Homologs in group_63

Help

12 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03110 FBDBKF_03110 100.0 Morganella morganii S1 gltD NADPH-dependent glutamate synthase beta chain or related oxidoreductase
FBDBKF_04805 FBDBKF_04805 53.4 Morganella morganii S1 hycB Fe-S-cluster-containing hydrogenase component 2
EHELCC_06095 EHELCC_06095 53.4 Morganella morganii S2 hycB Fe-S-cluster-containing hydrogenase component 2
EHELCC_07425 EHELCC_07425 100.0 Morganella morganii S2 gltD NADPH-dependent glutamate synthase beta chain or related oxidoreductase
NLDBIP_06415 NLDBIP_06415 53.4 Morganella morganii S4 hycB Fe-S-cluster-containing hydrogenase component 2
NLDBIP_07750 NLDBIP_07750 100.0 Morganella morganii S4 gltD NADPH-dependent glutamate synthase beta chain or related oxidoreductase
LHKJJB_03295 LHKJJB_03295 53.4 Morganella morganii S3 hycB Fe-S-cluster-containing hydrogenase component 2
LHKJJB_07285 LHKJJB_07285 100.0 Morganella morganii S3 gltD NADPH-dependent glutamate synthase beta chain or related oxidoreductase
HKOGLL_06770 HKOGLL_06770 53.4 Morganella morganii S5 hycB Fe-S-cluster-containing hydrogenase component 2
F4V73_RS09275 F4V73_RS09275 53.2 Morganella psychrotolerans - FAD-dependent oxidoreductase
F4V73_RS11815 F4V73_RS11815 86.4 Morganella psychrotolerans - FAD-dependent oxidoreductase
PMI_RS18290 PMI_RS18290 69.6 Proteus mirabilis HI4320 - FAD-dependent oxidoreductase

Distribution of the homologs in the orthogroup group_63

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_63

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P09832 0.0 713 69 0 472 1 gltD Glutamate synthase [NADPH] small chain Escherichia coli (strain K12)
E1V8I0 0.0 615 62 2 469 1 gltD Glutamate synthase [NADPH] small chain Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)
P37127 0.0 608 61 1 461 2 aegA Putative oxidoreductase AegA Escherichia coli (strain K12)
Q46820 0.0 536 56 1 456 2 uacF Putative oxidoreductase UacF Escherichia coli (strain K12)
Q05756 1.52e-121 366 44 8 473 1 gltD Glutamate synthase [NADPH] small chain Azospirillum brasilense
O08340 2.23e-94 294 46 7 392 3 gltD Putative glutamate synthase [NADPH] small chain Cereibacter sphaeroides
O34399 2.15e-86 276 37 12 489 1 gltB Glutamate synthase [NADPH] small chain Bacillus subtilis (strain 168)
Q8U195 2.58e-81 262 36 8 461 1 sudA Sulfide dehydrogenase subunit alpha Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q9C102 5.43e-76 263 35 11 485 1 glt1 Glutamate synthase [NADH] Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P9WN19 1.1e-74 246 36 10 461 1 gltD Glutamate synthase [NADPH] small chain Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN18 1.1e-74 246 36 10 461 3 gltD Glutamate synthase [NADPH] small chain Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q0JKD0 8.4e-71 248 35 10 460 2 Os01g0681900 Glutamate synthase 1 [NADH], chloroplastic Oryza sativa subsp. japonica
Q03460 6.13e-70 245 35 11 488 1 None Glutamate synthase [NADH], amyloplastic Medicago sativa
Q9LV03 9.7e-70 244 33 11 489 1 GLT1 Glutamate synthase 1 [NADH], chloroplastic Arabidopsis thaliana
Q0DG35 8.19e-69 242 33 11 463 2 Os05g0555600 Glutamate synthase 2 [NADH], chloroplastic Oryza sativa subsp. japonica
Q12680 2.03e-65 232 34 13 483 1 GLT1 Glutamate synthase [NADH] Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q74FU5 1.25e-59 210 34 7 439 1 sfrB NADPH-Fe(3+) oxidoreductase subunit beta Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
D7AF64 1.25e-59 210 34 7 439 3 sfrB NADPH-Fe(3+) oxidoreductase subunit beta Geobacter sulfurreducens (strain DL-1 / KN400)
Q8X645 1.23e-53 188 31 11 442 3 preT NAD-dependent dihydropyrimidine dehydrogenase subunit PreT Escherichia coli O157:H7
Q8ZNL8 9.83e-52 183 31 14 445 3 preT NAD-dependent dihydropyrimidine dehydrogenase subunit PreT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P76440 1e-51 183 31 11 441 1 preT NAD-dependent dihydropyrimidine dehydrogenase subunit PreT Escherichia coli (strain K12)
Q8Z5A6 4.64e-50 179 30 14 445 3 preT NAD-dependent dihydropyrimidine dehydrogenase subunit PreT homolog Salmonella typhi
O89000 4.26e-43 166 30 14 446 2 Dpyd Dihydropyrimidine dehydrogenase [NADP(+)] Rattus norvegicus
Q28943 5.23e-43 166 29 14 448 1 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Sus scrofa
Q28007 3.8e-42 163 29 13 448 1 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Bos taurus
Q46811 7.15e-42 162 33 16 425 1 ygfK Putative oxidoreductase YgfK Escherichia coli (strain K12)
Q8XD75 1.05e-41 162 33 16 425 3 ygfK Putative oxidoreductase YgfK Escherichia coli O157:H7
Q12882 1.69e-41 161 29 13 452 1 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Homo sapiens
Q8CHR6 4.31e-41 160 30 15 446 1 Dpyd Dihydropyrimidine dehydrogenase [NADP(+)] Mus musculus
Q5R895 9.37e-41 159 28 12 452 2 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Pongo abelii
Q18164 7.64e-40 157 30 12 446 3 dpyd-1 Dihydropyrimidine dehydrogenase [NADP(+)] Caenorhabditis elegans
A8XKG6 2.67e-38 152 30 12 435 3 dpyd-1 Probable dihydropyrimidine dehydrogenase [NADP(+)] Caenorhabditis briggsae
Q55FT1 3.35e-37 149 28 13 444 2 pyd1 Dihydropyrimidine dehydrogenase [NADP(+)] Dictyostelium discoideum
Q6NYG8 5.74e-37 148 28 13 450 2 dpyd Dihydropyrimidine dehydrogenase [NADP(+)] Danio rerio
P82861 4.81e-13 74 27 7 230 2 fdxr NADPH:adrenodoxin oxidoreductase, mitochondrial Salvelinus fontinalis
Q8CPY8 2.27e-11 68 27 16 344 3 trxB Thioredoxin reductase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQW4 2.27e-11 68 27 16 344 3 trxB Thioredoxin reductase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P66011 4.35e-11 67 28 17 345 1 trxB Thioredoxin reductase Staphylococcus aureus (strain MW2)
Q6GB66 4.35e-11 67 28 17 345 3 trxB Thioredoxin reductase Staphylococcus aureus (strain MSSA476)
P99101 4.35e-11 67 28 17 345 1 trxB Thioredoxin reductase Staphylococcus aureus (strain N315)
P66010 4.35e-11 67 28 17 345 3 trxB Thioredoxin reductase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HHQ4 4.35e-11 67 28 17 345 3 trxB Thioredoxin reductase Staphylococcus aureus (strain COL)
Q8VQF5 4.86e-11 68 31 6 167 3 cinB Cindoxin reductase Citrobacter braakii
Q6GIM7 1.99e-10 65 27 17 345 3 trxB Thioredoxin reductase Staphylococcus aureus (strain MRSA252)
A3CM39 2.35e-10 65 24 13 347 3 SSA_0813 Ferredoxin--NADP reductase Streptococcus sanguinis (strain SK36)
A8AA47 2.83e-10 64 24 13 338 3 Igni_0617 Ferredoxin--NADP reductase Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
P9WJI1 7.01e-10 65 30 4 165 1 fprB Probable ferredoxin/ferredoxin--NADP reductase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJI0 7.01e-10 65 30 4 165 3 fprB Probable ferredoxin/ferredoxin--NADP reductase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P65529 7.01e-10 65 30 4 165 3 fprB Probable ferredoxin/ferredoxin--NADP reductase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O59710 9.44e-10 64 28 5 170 3 arh1 Probable NADPH:adrenodoxin oxidoreductase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q483W3 1.01e-09 63 26 17 349 3 CPS_1923 Ferredoxin--NADP reductase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
O30973 1.13e-09 63 24 12 320 3 trxB Thioredoxin reductase Mycolicibacterium smegmatis
A8AXQ6 6.73e-09 60 23 12 346 3 SGO_1284 Ferredoxin--NADP reductase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B4S9F8 7.18e-09 60 25 19 352 3 Paes_1610 Ferredoxin--NADP reductase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
P22570 1.65e-08 60 27 4 162 1 FDXR NADPH:adrenodoxin oxidoreductase, mitochondrial Homo sapiens
Q8KCB2 1.75e-08 59 23 15 356 1 CT1512 Ferredoxin--NADP reductase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q61578 2.57e-08 59 29 7 166 1 Fdxr NADPH:adrenodoxin oxidoreductase, mitochondrial Mus musculus
O33064 2.66e-08 59 29 4 158 3 fprB Probable ferredoxin/ferredoxin--NADP reductase Mycobacterium leprae (strain TN)
P08165 3.11e-08 59 28 5 164 1 FDXR NADPH:adrenodoxin oxidoreductase, mitochondrial Bos taurus
Q8W3L1 3.88e-08 59 27 7 191 1 MFDR NADPH:adrenodoxin oxidoreductase, mitochondrial Arabidopsis thaliana
Q05741 4.06e-08 58 23 12 320 1 trxB Thioredoxin reductase Streptomyces clavuligerus
P80880 4.06e-08 58 26 16 339 1 trxB Thioredoxin reductase Bacillus subtilis (strain 168)
Q9V3T9 6.05e-08 58 28 7 174 2 dare NADPH:adrenodoxin oxidoreductase, mitochondrial Drosophila melanogaster
B3EEF0 8.29e-08 57 21 12 356 3 Clim_1719 Ferredoxin--NADP reductase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
P9WHH1 8.39e-08 57 27 13 333 1 trxB Thioredoxin reductase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHH0 8.39e-08 57 27 13 333 3 trxB Thioredoxin reductase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
B1HW35 1.2e-07 57 23 13 348 3 Bsph_2322 Ferredoxin--NADP reductase 3 Lysinibacillus sphaericus (strain C3-41)
P52215 2.89e-07 55 23 11 321 2 trxB Thioredoxin reductase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A4VXW3 3.85e-07 55 22 16 348 3 SSU05_1986 Ferredoxin--NADP reductase Streptococcus suis (strain 05ZYH33)
A4W460 3.85e-07 55 22 16 348 3 SSU98_1991 Ferredoxin--NADP reductase Streptococcus suis (strain 98HAH33)
Q928B5 4.54e-07 55 30 9 188 3 trxB Thioredoxin reductase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B5E6K6 8.11e-07 54 23 15 347 3 SPG_1489 Ferredoxin--NADP reductase Streptococcus pneumoniae serotype 19F (strain G54)
O32823 8.36e-07 54 29 9 189 3 trxB Thioredoxin reductase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8DP13 8.56e-07 54 23 15 348 3 spr1421 Ferredoxin--NADP reductase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04JI5 8.56e-07 54 23 15 348 3 SPD_1393 Ferredoxin--NADP reductase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P56522 8.64e-07 55 28 7 169 1 Fdxr NADPH:adrenodoxin oxidoreductase, mitochondrial Rattus norvegicus
O18480 9.9e-07 54 23 13 352 2 None Dihydrolipoyl dehydrogenase Manduca sexta
B1ICY3 1.05e-06 53 23 15 347 3 SPH_1677 Ferredoxin--NADP reductase Streptococcus pneumoniae (strain Hungary19A-6)
B2IR81 1.22e-06 53 23 15 346 3 SPCG_1548 Ferredoxin--NADP reductase Streptococcus pneumoniae (strain CGSP14)
Q97PP0 1.22e-06 53 23 15 346 3 SP_1563 Ferredoxin--NADP reductase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q65FE0 1.99e-06 53 24 16 326 3 BLi03393 Ferredoxin--NADP reductase 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A4SVT8 2.35e-06 53 23 14 332 3 Pnuc_0382 Ferredoxin--NADP reductase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q82ZZ8 2.37e-06 53 23 16 357 3 EF_2899 Ferredoxin--NADP reductase Enterococcus faecalis (strain ATCC 700802 / V583)
A9NFF6 2.55e-06 52 23 17 355 3 ACL_0467 Ferredoxin--NADP reductase Acholeplasma laidlawii (strain PG-8A)
Q8ENX4 2.72e-06 52 24 13 349 3 OB2351 Ferredoxin--NADP reductase 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8DUN5 3.25e-06 52 23 16 356 3 SMU_869 Ferredoxin--NADP reductase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B4SFQ3 4.23e-06 52 28 9 195 3 Ppha_1024 Ferredoxin--NADP reductase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A8FH11 4.89e-06 52 24 15 327 3 BPUM_2873 Ferredoxin--NADP reductase 2 Bacillus pumilus (strain SAFR-032)
P46843 5.06e-06 52 26 18 337 3 trxB/A Bifunctional thioredoxin reductase/thioredoxin Mycobacterium leprae (strain TN)
B4U394 5.26e-06 52 23 15 348 3 Sez_1109 Ferredoxin--NADP reductase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
A1BHP4 5.46e-06 52 27 6 164 3 Cpha266_1905 Ferredoxin--NADP reductase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B3QPZ8 5.52e-06 52 24 10 216 3 Cpar_1603 Ferredoxin--NADP reductase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q5WAF1 6.15e-06 52 29 8 188 3 ABC0094 Ferredoxin--NADP reductase 1 Shouchella clausii (strain KSM-K16)
A4SFT9 7.4e-06 51 26 7 193 3 Cvib_1336 Ferredoxin--NADP reductase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
O31475 9.52e-06 51 26 19 349 1 ycgT Ferredoxin--NADP reductase 1 Bacillus subtilis (strain 168)
Q04HB6 1.28e-05 50 26 18 361 3 OEOE_0163 Ferredoxin--NADP reductase Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
P94284 1.77e-05 50 24 17 339 3 trxB Thioredoxin reductase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q3B2Q8 2.24e-05 50 24 7 193 3 Plut_1516 Ferredoxin--NADP reductase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
P56431 2.45e-05 49 23 15 340 1 trxB Thioredoxin reductase Helicobacter pylori (strain ATCC 700392 / 26695)
B2JN27 2.52e-05 50 25 15 341 3 Bphy_3740 Ferredoxin--NADP reductase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q4L8N5 2.88e-05 49 22 15 345 3 SH0681 Ferredoxin--NADP reductase Staphylococcus haemolyticus (strain JCSC1435)
O32886 3.62e-05 49 27 5 168 3 fprA NADPH-ferredoxin reductase FprA Mycobacterium leprae (strain TN)
Q74KS6 3.7e-05 49 23 10 272 3 LJ_0501 Ferredoxin--NADP reductase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q2JFM8 4.16e-05 49 26 13 314 3 Francci3_0530 Ferredoxin--NADP reductase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q9ZL18 4.37e-05 48 23 15 340 3 trxB Thioredoxin reductase Helicobacter pylori (strain J99 / ATCC 700824)
Q67QU3 4.63e-05 48 23 15 328 3 STH965 Ferredoxin--NADP reductase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P48360 5.82e-05 49 27 7 188 1 ARH1 Probable NADPH:adrenodoxin oxidoreductase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q03JS2 9.55e-05 48 25 17 351 3 STER_1382 Ferredoxin--NADP reductase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M3J6 9.55e-05 48 25 17 351 3 stu1417 Ferredoxin--NADP reductase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LYY3 9.55e-05 48 25 17 351 3 str1417 Ferredoxin--NADP reductase Streptococcus thermophilus (strain CNRZ 1066)
Q65GY3 0.000126 47 22 9 316 3 BLi02810 Ferredoxin--NADP reductase 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q48303 0.000152 48 23 3 173 3 dmd Dimethylamine dehydrogenase Hyphomicrobium sp. (strain x)
Q5KVP7 0.000189 47 22 13 320 3 GK2954 Ferredoxin--NADP reductase Geobacillus kaustophilus (strain HTA426)
Q04799 0.000248 47 50 0 42 1 FMO5 Flavin-containing monooxygenase 5 Oryctolagus cuniculus
G0SB20 0.000266 47 23 13 313 1 CTHT_0048590 Dihydrolipoamide dehydrogenase Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
Q9I3D1 0.000305 47 30 8 188 1 lpdG Dihydrolipoyl dehydrogenase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P14218 0.00031 47 30 8 188 1 lpd Dihydrolipoyl dehydrogenase Pseudomonas fluorescens
Q96YN9 0.000314 46 23 14 324 3 STK_21330 Ferredoxin--NADP reductase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q5FLU4 0.000404 45 23 16 334 3 LBA0439 Ferredoxin--NADP reductase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q9ZD33 0.000491 45 23 14 337 3 RP514 Ferredoxin--NADP reductase Rickettsia prowazekii (strain Madrid E)
Q9Z8M4 0.000526 45 27 8 171 3 trxB Thioredoxin reductase Chlamydia pneumoniae
Q7A3W1 0.00055 45 27 9 190 1 SA2162 Ferredoxin--NADP reductase Staphylococcus aureus (strain N315)
Q6HP49 0.000564 45 23 12 324 3 BT9727_0321 Ferredoxin--NADP reductase 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81ZB7 0.000564 45 23 12 324 3 BA_0352 Ferredoxin--NADP reductase 1 Bacillus anthracis
A0R951 0.000564 45 23 12 324 3 BALH_0343 Ferredoxin--NADP reductase 1 Bacillus thuringiensis (strain Al Hakam)
A7Z8C1 0.000613 45 23 15 326 3 RBAM_029160 Ferredoxin--NADP reductase 2 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P0A9P4 0.001 45 24 14 325 1 trxB Thioredoxin reductase Escherichia coli (strain K12)
P0A9P5 0.001 45 24 14 325 3 trxB Thioredoxin reductase Escherichia coli O157:H7
P29509 0.001 45 25 15 327 1 TRR1 Thioredoxin reductase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A0LT79 0.001 45 24 11 315 3 Acel_0866 Ferredoxin--NADP reductase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q9SXE1 0.001 45 48 0 43 1 FMOGS-OX3 Flavin-containing monooxygenase FMO GS-OX3 Arabidopsis thaliana
P19410 0.001 45 27 4 122 1 baiCD 3-oxocholoyl-CoA 4-desaturase Clostridium scindens (strain JCM 10418 / VPI 12708)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_03645
Feature type CDS
Gene gltD
Product NADPH-dependent glutamate synthase beta chain or related oxidoreductase
Location 47470 - 48888 (strand: 1)
Length 1419 (nucleotides) / 472 (amino acids)

Contig

Accession ZDB_681
Length 269562 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_63
Orthogroup size 13
N. genomes 7

Actions

Genomic region

Domains

PF07992 Pyridine nucleotide-disulphide oxidoreductase
PF14691 Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0493 Amino acid transport and metabolism (E)
General function prediction only (R)		 ER NADPH-dependent glutamate synthase beta chain or related oxidoreductase

Kegg Ortholog Annotation(s)

Protein Sequence

MSRNVYQFIELQRTDPQKLPLALRKTEFIEIYEPFSPPQVKEQATRCLGCGNPYCEWKCPVHNYIPNWLRLAEEGRIIEAAELSHQTNSLPEVCGRVCPQDRLCEGACTLHDEFGAVTIGNIERYITDKAFEMGWKPDLSAVRPTGRKVAVIGAGPAGLACADVLIRNGVTPVVFDKHPEIGGLLTFGIPSFKLEKSIMQRRRELFTEMGVEFQLNTEIGKEITLSELQQNYDAVFIGAGTYQPMGGGLKNEDAAGVYSALPYLIGNTRQVMGLPDDDSAPFIDLKNKRVVVLGGGDTAMDCLRTAIRQGAAEVTCVYRRDEENMPGSRREVKNAKEEGVNFRFNCQPSAIETDATGNACGVRVLTTRLGDADSSGRRQIETDDNSAFVIDADAVIIAFGFRPHAMPWLDALSVTRDQQGRISAPAQATYPFETSVSGIFAGGDVVRGSDLVVTAIAEGRRAAESILDYLHV

Flanking regions ( +/- flanking 50bp)

CGCCACGCAGACACTGAATTACGGATCCGGGCACAGTAAGGAGAATTAAGATGAGCCGCAATGTTTATCAGTTTATTGAATTACAGCGTACGGATCCGCAAAAGCTGCCGCTGGCACTCCGTAAAACCGAATTTATCGAGATTTATGAGCCGTTTTCGCCGCCGCAGGTGAAAGAGCAGGCGACCCGCTGCCTCGGCTGCGGTAATCCGTACTGTGAATGGAAATGCCCGGTACATAACTATATCCCCAACTGGCTGCGGCTGGCGGAGGAAGGCCGGATTATTGAGGCCGCAGAGCTGTCACACCAGACCAACAGCCTGCCGGAAGTATGCGGCCGGGTGTGTCCGCAGGACCGGCTGTGCGAAGGTGCCTGTACCCTGCATGATGAGTTCGGCGCGGTCACCATCGGCAATATTGAACGTTACATCACCGATAAAGCCTTTGAAATGGGCTGGAAACCGGATCTCTCCGCTGTCCGTCCGACCGGAAGAAAGGTCGCGGTAATTGGCGCCGGTCCGGCCGGGCTGGCCTGTGCCGATGTTCTGATCCGTAACGGCGTAACCCCGGTGGTCTTTGATAAGCACCCGGAAATCGGCGGGCTTCTCACCTTTGGTATTCCGTCGTTTAAGCTGGAAAAATCCATTATGCAGCGCCGCCGTGAGCTGTTCACAGAGATGGGCGTGGAGTTTCAGCTGAATACCGAGATCGGAAAAGAGATCACGCTCAGTGAGTTACAGCAGAATTATGATGCCGTCTTTATTGGTGCGGGCACCTATCAGCCGATGGGCGGCGGGCTGAAAAATGAAGATGCCGCCGGGGTGTACAGCGCCCTGCCGTATCTGATCGGCAATACCCGTCAGGTGATGGGGTTGCCGGATGATGATTCCGCTCCGTTTATTGACCTGAAGAATAAACGCGTCGTGGTACTCGGCGGCGGAGATACGGCAATGGATTGCCTGCGGACCGCCATCCGTCAGGGTGCTGCAGAAGTGACCTGTGTGTACCGCCGGGATGAGGAGAACATGCCGGGCTCGCGCCGTGAGGTGAAAAATGCCAAAGAGGAAGGGGTTAATTTCCGTTTTAACTGTCAGCCATCCGCCATTGAAACCGATGCAACGGGTAACGCCTGTGGTGTCCGCGTATTAACCACCCGGTTGGGTGATGCGGACAGCAGCGGCCGCCGTCAGATTGAAACGGATGATAATTCCGCCTTTGTTATTGATGCCGATGCGGTCATTATCGCGTTCGGTTTCCGGCCGCACGCGATGCCGTGGCTGGACGCTCTCAGTGTCACACGGGATCAGCAGGGCCGGATCAGCGCCCCGGCACAGGCAACTTATCCGTTTGAAACCTCCGTCAGCGGTATTTTCGCCGGCGGGGATGTGGTACGCGGCTCGGATCTGGTGGTTACCGCCATTGCCGAAGGCCGCCGGGCGGCAGAAAGTATTCTCGATTATCTGCACGTATGAGCAGAGTAATTACCTGATCATGCTGCCTTAAATGCAAAAAAGACCGCTTT