Homologs in group_63

Help

12 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03110 FBDBKF_03110 86.4 Morganella morganii S1 gltD NADPH-dependent glutamate synthase beta chain or related oxidoreductase
FBDBKF_04805 FBDBKF_04805 52.3 Morganella morganii S1 hycB Fe-S-cluster-containing hydrogenase component 2
EHELCC_06095 EHELCC_06095 52.3 Morganella morganii S2 hycB Fe-S-cluster-containing hydrogenase component 2
EHELCC_07425 EHELCC_07425 86.4 Morganella morganii S2 gltD NADPH-dependent glutamate synthase beta chain or related oxidoreductase
NLDBIP_06415 NLDBIP_06415 52.3 Morganella morganii S4 hycB Fe-S-cluster-containing hydrogenase component 2
NLDBIP_07750 NLDBIP_07750 86.4 Morganella morganii S4 gltD NADPH-dependent glutamate synthase beta chain or related oxidoreductase
LHKJJB_03295 LHKJJB_03295 52.3 Morganella morganii S3 hycB Fe-S-cluster-containing hydrogenase component 2
LHKJJB_07285 LHKJJB_07285 86.4 Morganella morganii S3 gltD NADPH-dependent glutamate synthase beta chain or related oxidoreductase
HKOGLL_03645 HKOGLL_03645 86.4 Morganella morganii S5 gltD NADPH-dependent glutamate synthase beta chain or related oxidoreductase
HKOGLL_06770 HKOGLL_06770 52.3 Morganella morganii S5 hycB Fe-S-cluster-containing hydrogenase component 2
F4V73_RS09275 F4V73_RS09275 51.9 Morganella psychrotolerans - FAD-dependent oxidoreductase
PMI_RS18290 PMI_RS18290 70.5 Proteus mirabilis HI4320 - FAD-dependent oxidoreductase

Distribution of the homologs in the orthogroup group_63

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_63

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P09832 0.0 701 69 0 472 1 gltD Glutamate synthase [NADPH] small chain Escherichia coli (strain K12)
E1V8I0 0.0 609 61 2 469 1 gltD Glutamate synthase [NADPH] small chain Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)
P37127 0.0 598 60 1 461 2 aegA Putative oxidoreductase AegA Escherichia coli (strain K12)
Q46820 0.0 535 56 1 451 2 uacF Putative oxidoreductase UacF Escherichia coli (strain K12)
Q05756 3.21e-125 375 44 6 467 1 gltD Glutamate synthase [NADPH] small chain Azospirillum brasilense
O08340 3.09e-96 299 46 6 389 3 gltD Putative glutamate synthase [NADPH] small chain Cereibacter sphaeroides
O34399 6.6e-84 270 36 14 490 1 gltB Glutamate synthase [NADPH] small chain Bacillus subtilis (strain 168)
Q8U195 7.89e-82 264 35 8 461 1 sudA Sulfide dehydrogenase subunit alpha Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q9C102 4.38e-80 275 36 11 481 1 glt1 Glutamate synthase [NADH] Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P9WN19 2.54e-76 250 36 10 454 1 gltD Glutamate synthase [NADPH] small chain Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN18 2.54e-76 250 36 10 454 3 gltD Glutamate synthase [NADPH] small chain Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q0JKD0 3.16e-73 254 35 11 466 2 Os01g0681900 Glutamate synthase 1 [NADH], chloroplastic Oryza sativa subsp. japonica
Q0DG35 1.03e-71 250 35 14 459 2 Os05g0555600 Glutamate synthase 2 [NADH], chloroplastic Oryza sativa subsp. japonica
Q03460 4.8e-71 248 36 11 455 1 None Glutamate synthase [NADH], amyloplastic Medicago sativa
Q9LV03 5.19e-71 248 35 11 457 1 GLT1 Glutamate synthase 1 [NADH], chloroplastic Arabidopsis thaliana
Q12680 3.64e-68 240 35 12 468 1 GLT1 Glutamate synthase [NADH] Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q74FU5 3.05e-58 206 32 8 437 1 sfrB NADPH-Fe(3+) oxidoreductase subunit beta Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
D7AF64 3.05e-58 206 32 8 437 3 sfrB NADPH-Fe(3+) oxidoreductase subunit beta Geobacter sulfurreducens (strain DL-1 / KN400)
Q8ZNL8 5.84e-51 181 31 12 447 3 preT NAD-dependent dihydropyrimidine dehydrogenase subunit PreT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8X645 1.3e-50 180 30 10 443 3 preT NAD-dependent dihydropyrimidine dehydrogenase subunit PreT Escherichia coli O157:H7
P76440 1.7e-50 180 30 9 442 1 preT NAD-dependent dihydropyrimidine dehydrogenase subunit PreT Escherichia coli (strain K12)
Q8Z5A6 8.33e-49 175 31 14 447 3 preT NAD-dependent dihydropyrimidine dehydrogenase subunit PreT homolog Salmonella typhi
Q28007 9.32e-45 171 29 14 451 1 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Bos taurus
Q28943 2.4e-43 167 28 13 451 1 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Sus scrofa
O89000 1.56e-42 164 28 14 453 2 Dpyd Dihydropyrimidine dehydrogenase [NADP(+)] Rattus norvegicus
Q18164 1.08e-41 162 30 14 468 3 dpyd-1 Dihydropyrimidine dehydrogenase [NADP(+)] Caenorhabditis elegans
Q12882 1.36e-41 162 28 14 451 1 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Homo sapiens
Q8CHR6 5.34e-41 160 28 15 449 1 Dpyd Dihydropyrimidine dehydrogenase [NADP(+)] Mus musculus
Q5R895 6.09e-41 160 28 13 451 2 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Pongo abelii
Q6NYG8 1.04e-40 159 28 15 467 2 dpyd Dihydropyrimidine dehydrogenase [NADP(+)] Danio rerio
A8XKG6 2.36e-39 155 30 14 457 3 dpyd-1 Probable dihydropyrimidine dehydrogenase [NADP(+)] Caenorhabditis briggsae
Q55FT1 8.34e-37 147 27 15 448 2 pyd1 Dihydropyrimidine dehydrogenase [NADP(+)] Dictyostelium discoideum
Q46811 1.49e-36 147 31 16 426 1 ygfK Putative oxidoreductase YgfK Escherichia coli (strain K12)
Q8XD75 1.56e-36 147 31 16 426 3 ygfK Putative oxidoreductase YgfK Escherichia coli O157:H7
P82861 2.92e-13 75 27 6 228 2 fdxr NADPH:adrenodoxin oxidoreductase, mitochondrial Salvelinus fontinalis
Q483W3 1.69e-12 72 28 16 346 3 CPS_1923 Ferredoxin--NADP reductase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
P9WJI1 8.95e-12 70 32 4 165 1 fprB Probable ferredoxin/ferredoxin--NADP reductase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJI0 8.95e-12 70 32 4 165 3 fprB Probable ferredoxin/ferredoxin--NADP reductase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P65529 8.95e-12 70 32 4 165 3 fprB Probable ferredoxin/ferredoxin--NADP reductase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8VQF5 1.38e-11 70 31 5 160 3 cinB Cindoxin reductase Citrobacter braakii
Q8W3L1 3.51e-11 68 28 6 191 1 MFDR NADPH:adrenodoxin oxidoreductase, mitochondrial Arabidopsis thaliana
Q61578 1.63e-10 66 32 6 161 1 Fdxr NADPH:adrenodoxin oxidoreductase, mitochondrial Mus musculus
Q8CPY8 1.9e-10 65 27 15 337 3 trxB Thioredoxin reductase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQW4 1.9e-10 65 27 15 337 3 trxB Thioredoxin reductase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P08165 2.66e-10 66 30 4 162 1 FDXR NADPH:adrenodoxin oxidoreductase, mitochondrial Bos taurus
P66011 3.63e-10 64 33 9 192 1 trxB Thioredoxin reductase Staphylococcus aureus (strain MW2)
Q6GB66 3.63e-10 64 33 9 192 3 trxB Thioredoxin reductase Staphylococcus aureus (strain MSSA476)
P99101 3.63e-10 64 33 9 192 1 trxB Thioredoxin reductase Staphylococcus aureus (strain N315)
P66010 3.63e-10 64 33 9 192 3 trxB Thioredoxin reductase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HHQ4 3.63e-10 64 33 9 192 3 trxB Thioredoxin reductase Staphylococcus aureus (strain COL)
O33064 4.06e-10 65 28 7 250 3 fprB Probable ferredoxin/ferredoxin--NADP reductase Mycobacterium leprae (strain TN)
P22570 6.59e-10 64 29 4 161 1 FDXR NADPH:adrenodoxin oxidoreductase, mitochondrial Homo sapiens
A4SVT8 6.74e-10 64 25 15 326 3 Pnuc_0382 Ferredoxin--NADP reductase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
P56522 9.51e-10 64 30 6 168 1 Fdxr NADPH:adrenodoxin oxidoreductase, mitochondrial Rattus norvegicus
Q6GIM7 1.2e-09 63 32 9 192 3 trxB Thioredoxin reductase Staphylococcus aureus (strain MRSA252)
Q9V3T9 1.33e-09 63 30 6 173 2 dare NADPH:adrenodoxin oxidoreductase, mitochondrial Drosophila melanogaster
Q8KCB2 2.02e-09 62 23 13 359 1 CT1512 Ferredoxin--NADP reductase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
O59710 5.18e-09 62 25 6 189 3 arh1 Probable NADPH:adrenodoxin oxidoreductase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A3CM39 5.67e-09 61 23 14 346 3 SSA_0813 Ferredoxin--NADP reductase Streptococcus sanguinis (strain SK36)
A8AXQ6 8.07e-09 60 22 13 346 3 SGO_1284 Ferredoxin--NADP reductase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q8ENX4 1.06e-08 60 26 16 348 3 OB2351 Ferredoxin--NADP reductase 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A8AA47 1.5e-08 59 24 14 341 3 Igni_0617 Ferredoxin--NADP reductase Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
B3QPZ8 3.67e-08 58 26 11 224 3 Cpar_1603 Ferredoxin--NADP reductase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
O32886 6.83e-08 58 26 10 240 3 fprA NADPH-ferredoxin reductase FprA Mycobacterium leprae (strain TN)
Q5FLU4 9.62e-08 57 24 17 339 3 LBA0439 Ferredoxin--NADP reductase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A4ISE6 1.49e-07 56 24 14 326 3 GTNG_2905 Ferredoxin--NADP reductase Geobacillus thermodenitrificans (strain NG80-2)
Q54KG7 3.01e-07 56 26 6 184 3 fdxr Probable NADPH:adrenodoxin oxidoreductase, mitochondrial Dictyostelium discoideum
Q8DUN5 3.34e-07 55 24 15 356 3 SMU_869 Ferredoxin--NADP reductase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q74KS6 6.3e-07 54 24 13 277 3 LJ_0501 Ferredoxin--NADP reductase Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
B3QXR3 8.99e-07 54 24 10 318 3 Ctha_2529 Ferredoxin--NADP reductase 2 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q045M0 9.18e-07 54 25 14 274 3 LGAS_0447 Ferredoxin--NADP reductase Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
O18480 1.07e-06 54 24 15 352 2 None Dihydrolipoyl dehydrogenase Manduca sexta
O30973 1.22e-06 53 24 14 316 3 trxB Thioredoxin reductase Mycolicibacterium smegmatis
Q3B2Q8 1.49e-06 53 26 8 193 3 Plut_1516 Ferredoxin--NADP reductase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
P48360 1.75e-06 53 27 4 177 1 ARH1 Probable NADPH:adrenodoxin oxidoreductase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B4SFQ3 1.8e-06 53 27 8 192 3 Ppha_1024 Ferredoxin--NADP reductase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q1LPH7 2.11e-06 53 26 16 340 3 Rmet_1063 Ferredoxin--NADP reductase 1 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q473F6 2.36e-06 53 26 19 345 3 Reut_A1099 Ferredoxin--NADP reductase 1 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B4U394 2.64e-06 52 23 13 348 3 Sez_1109 Ferredoxin--NADP reductase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
B3EEF0 3.01e-06 52 21 13 356 3 Clim_1719 Ferredoxin--NADP reductase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q5WDV1 4.73e-06 52 25 17 335 3 ABC2925 Ferredoxin--NADP reductase 2 Shouchella clausii (strain KSM-K16)
O31475 4.84e-06 52 29 10 191 1 ycgT Ferredoxin--NADP reductase 1 Bacillus subtilis (strain 168)
Q65GY3 5.12e-06 52 23 11 319 3 BLi02810 Ferredoxin--NADP reductase 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B5E6K6 5.18e-06 52 23 14 346 3 SPG_1489 Ferredoxin--NADP reductase Streptococcus pneumoniae serotype 19F (strain G54)
Q9ZD33 5.74e-06 52 23 15 338 3 RP514 Ferredoxin--NADP reductase Rickettsia prowazekii (strain Madrid E)
P9WIQ3 7.22e-06 52 24 7 231 1 fprA NADPH-ferredoxin reductase FprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIQ2 7.22e-06 52 24 7 231 3 fprA NADPH-ferredoxin reductase FprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
B2IR81 9.06e-06 51 23 14 345 3 SPCG_1548 Ferredoxin--NADP reductase Streptococcus pneumoniae (strain CGSP14)
Q97PP0 9.06e-06 51 23 14 345 3 SP_1563 Ferredoxin--NADP reductase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A4SFT9 9.15e-06 51 27 10 196 3 Cvib_1336 Ferredoxin--NADP reductase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q4JCM0 1.17e-05 50 23 17 326 3 Saci_0029 Ferredoxin--NADP reductase 1 Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
P94284 1.32e-05 50 23 15 357 3 trxB Thioredoxin reductase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q8DP13 1.58e-05 50 23 14 346 3 spr1421 Ferredoxin--NADP reductase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04JI5 1.58e-05 50 23 14 346 3 SPD_1393 Ferredoxin--NADP reductase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A5FJT9 1.58e-05 50 25 17 329 3 Fjoh_1507 Ferredoxin--NADP reductase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q82ZZ8 1.61e-05 50 22 15 350 3 EF_2899 Ferredoxin--NADP reductase Enterococcus faecalis (strain ATCC 700802 / V583)
B3QXE1 2.01e-05 50 25 16 342 3 Ctha_0950 Ferredoxin--NADP reductase 1 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
P46843 2.02e-05 50 26 16 334 3 trxB/A Bifunctional thioredoxin reductase/thioredoxin Mycobacterium leprae (strain TN)
P9WHH1 2.04e-05 50 23 12 332 1 trxB Thioredoxin reductase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHH0 2.04e-05 50 23 12 332 3 trxB Thioredoxin reductase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A4VXW3 2.26e-05 50 22 16 346 3 SSU05_1986 Ferredoxin--NADP reductase Streptococcus suis (strain 05ZYH33)
A4W460 2.26e-05 50 22 16 346 3 SSU98_1991 Ferredoxin--NADP reductase Streptococcus suis (strain 98HAH33)
Q68WM0 2.51e-05 50 23 17 346 3 RT0500 Ferredoxin--NADP reductase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A7Z171 2.53e-05 50 25 15 355 3 RBAM_003480 Ferredoxin--NADP reductase 1 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q67QU3 2.6e-05 49 23 15 327 3 STH965 Ferredoxin--NADP reductase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B1ICY3 2.77e-05 49 23 14 346 3 SPH_1677 Ferredoxin--NADP reductase Streptococcus pneumoniae (strain Hungary19A-6)
P80880 3.18e-05 49 28 9 188 1 trxB Thioredoxin reductase Bacillus subtilis (strain 168)
P21880 3.26e-05 50 26 12 261 3 pdhD Dihydrolipoyl dehydrogenase Bacillus subtilis (strain 168)
Q54EW8 3.34e-05 50 26 7 215 3 lpd Dihydrolipoyl dehydrogenase, mitochondrial Dictyostelium discoideum
O05268 3.83e-05 49 22 14 327 1 yumC Ferredoxin--NADP reductase 2 Bacillus subtilis (strain 168)
Q65FE0 3.9e-05 49 23 14 327 3 BLi03393 Ferredoxin--NADP reductase 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q96YN9 4e-05 49 24 18 327 3 STK_21330 Ferredoxin--NADP reductase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q04HB6 4.42e-05 49 23 16 355 3 OEOE_0163 Ferredoxin--NADP reductase Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q9K7F3 4.5e-05 48 22 14 333 3 BH3408 Ferredoxin--NADP reductase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A1BHP4 4.76e-05 48 23 14 317 3 Cpha266_1905 Ferredoxin--NADP reductase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q5FT88 5.56e-05 48 32 9 169 3 GOX0631 Ferredoxin--NADP reductase Gluconobacter oxydans (strain 621H)
A8FH11 5.81e-05 48 23 14 327 3 BPUM_2873 Ferredoxin--NADP reductase 2 Bacillus pumilus (strain SAFR-032)
Q3AS18 7.8e-05 48 21 14 356 3 Cag_0944 Ferredoxin--NADP reductase Chlorobium chlorochromatii (strain CaD3)
Q9HN74 7.85e-05 48 24 15 370 3 lpdA Dihydrolipoyl dehydrogenase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q03JS2 8.51e-05 48 23 17 356 3 STER_1382 Ferredoxin--NADP reductase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M3J6 8.51e-05 48 23 17 356 3 stu1417 Ferredoxin--NADP reductase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LYY3 8.51e-05 48 23 17 356 3 str1417 Ferredoxin--NADP reductase Streptococcus thermophilus (strain CNRZ 1066)
P11959 0.000102 48 27 11 259 1 pdhD Dihydrolipoyl dehydrogenase Geobacillus stearothermophilus
Q5KVP7 0.000102 48 24 16 326 3 GK2954 Ferredoxin--NADP reductase Geobacillus kaustophilus (strain HTA426)
Q21VM4 0.000125 47 26 8 168 3 Rfer_2462 Ferredoxin--NADP reductase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B4S9F8 0.000131 47 22 18 350 3 Paes_1610 Ferredoxin--NADP reductase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q1RHV1 0.000132 47 24 16 337 3 RBE_0982 Ferredoxin--NADP reductase Rickettsia bellii (strain RML369-C)
Q3STP0 0.000146 47 24 15 350 3 Nwi_1089 Ferredoxin--NADP reductase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A2SFW9 0.000151 47 24 15 336 3 Mpe_A1496 Ferredoxin--NADP reductase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q0KCD1 0.000153 47 26 19 350 3 H16_A1199 Ferredoxin--NADP reductase 1 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P0A0E7 0.000159 47 28 6 179 3 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus (strain MW2)
P0A0E8 0.000159 47 28 6 179 3 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus
Q6GAB8 0.000159 47 28 6 179 3 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus (strain MSSA476)
Q6GHY9 0.000159 47 28 6 179 3 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus (strain MRSA252)
P99084 0.000159 47 28 6 179 1 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus (strain N315)
P0A0E6 0.000159 47 28 6 179 3 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGY8 0.000159 47 28 6 179 3 pdhD Dihydrolipoyl dehydrogenase Staphylococcus aureus (strain COL)
A9H9C9 0.000251 47 26 20 365 3 GDI0711 Ferredoxin--NADP reductase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q049B3 0.000253 46 24 17 308 3 LBUL_1466 Ferredoxin--NADP reductase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G967 0.000253 46 24 17 308 3 Ldb1586 Ferredoxin--NADP reductase Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
A8YTT2 0.000264 46 23 18 350 3 lhv_0465 Ferredoxin--NADP reductase Lactobacillus helveticus (strain DPC 4571)
O32823 0.000268 46 28 9 189 3 trxB Thioredoxin reductase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q05741 0.000271 46 23 12 316 1 trxB Thioredoxin reductase Streptomyces clavuligerus
Q97WJ5 0.000292 46 23 15 331 3 SSO2222 Ferredoxin--NADP reductase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q72LG3 0.000295 46 24 15 336 3 TT_C0096 Ferredoxin--NADP reductase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
F1N206 0.000307 47 23 14 361 1 DLD Dihydrolipoyl dehydrogenase, mitochondrial Bos taurus
Q8NV36 0.000394 46 22 11 345 3 MW2294 Ferredoxin--NADP reductase Staphylococcus aureus (strain MW2)
Q6G6U7 0.000394 46 22 11 345 3 SAS2264 Ferredoxin--NADP reductase Staphylococcus aureus (strain MSSA476)
Q48303 0.000406 46 22 2 165 3 dmd Dimethylamine dehydrogenase Hyphomicrobium sp. (strain x)
A8GW75 0.000413 46 24 16 337 3 A1I_03745 Ferredoxin--NADP reductase Rickettsia bellii (strain OSU 85-389)
Q2W0C9 0.000495 45 24 21 365 3 amb3892 Ferredoxin--NADP reductase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B1HZ05 0.000554 45 19 11 346 3 Bsph_0789 Ferredoxin--NADP reductase 1 Lysinibacillus sphaericus (strain C3-41)
B3EKW5 0.000609 45 21 10 340 3 Cphamn1_1733 Ferredoxin--NADP reductase Chlorobium phaeobacteroides (strain BS1)
Q9ZL18 0.000634 45 25 19 339 3 trxB Thioredoxin reductase Helicobacter pylori (strain J99 / ATCC 700824)
Q928B5 0.000744 45 28 9 188 3 trxB Thioredoxin reductase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q2YZ12 0.000806 45 22 11 345 3 SAB2252c Ferredoxin--NADP reductase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q5SL28 0.000868 45 24 15 336 1 TTHA0465 Ferredoxin--NADP reductase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q9SXE1 0.000898 45 48 0 43 1 FMOGS-OX3 Flavin-containing monooxygenase FMO GS-OX3 Arabidopsis thaliana
A4YER6 0.001 45 24 19 349 3 Msed_0743 Ferredoxin--NADP reductase Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11815
Feature type CDS
Gene -
Product FAD-dependent oxidoreductase
Location 512900 - 514318 (strand: -1)
Length 1419 (nucleotides) / 472 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_63
Orthogroup size 13
N. genomes 7

Actions

Genomic region

Domains

PF07992 Pyridine nucleotide-disulphide oxidoreductase
PF14691 Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0493 Amino acid transport and metabolism (E)
General function prediction only (R)		 ER NADPH-dependent glutamate synthase beta chain or related oxidoreductase

Kegg Ortholog Annotation(s)

Protein Sequence

MSRNVYQFIELQRIDPQKLPLVRRKTEFIEIYESFSHNQVQNQADRCLGCGNPYCEWKCPVHNYIPNWLKLAEEGRIIEAAELAHQTNSLPEVCGRVCPQDKLCEGACTLHDEFGAVTIGNIERYITDKAFEMGWKPDLSAVRPTGKTVAVIGAGPAGLACADVLIRNGVNAVVYDKHPEIGGLLTFGIPAFKLEKSIMQRRRELFTEMGIEFHLNTEIGKDISLSELQQQYDAVFIGAGTYQPMNGGLPNEQAPGVYSALPYLIGNTRHIMELPDDNSSPYIDLKNKRVVVLGGGDTAMDCLRTAIRQGAADVTCLYRRDEDNMPGSRREVKNAKEEGVNFQFHCQPSAIELNDRGDVSGVRVMATQLGGTDSNGRRIIETDNDSAYTIEADAVIIAFGFRPHAMPWLDALNIERDTQGRISASSQAQYPFETSVSGIFAGGDVVRGSDLVVTAIAEGRRAAESILDYLHV

Flanking regions ( +/- flanking 50bp)

AGCCGGGTCCATACCGAATTACGCTTGCGGACACCGCAGGGAGAAAAAATATGAGCCGCAATGTTTATCAATTTATTGAATTACAGCGTATTGATCCGCAAAAATTACCTCTGGTGCGCCGTAAAACAGAGTTTATCGAGATTTATGAGTCCTTCTCACACAACCAGGTGCAGAACCAGGCCGATCGCTGCCTCGGGTGCGGTAATCCCTACTGTGAATGGAAATGTCCGGTCCATAACTATATTCCAAACTGGCTGAAACTGGCGGAAGAAGGACGGATTATTGAAGCCGCCGAACTTGCCCATCAGACCAACAGTCTGCCGGAAGTGTGTGGACGGGTGTGCCCGCAGGACAAACTGTGTGAGGGCGCGTGTACGCTGCATGATGAATTTGGCGCGGTCACTATCGGCAATATTGAGCGCTACATTACGGATAAAGCCTTTGAAATGGGCTGGAAACCGGATCTCTCTGCGGTGCGCCCGACAGGTAAAACCGTGGCGGTGATTGGTGCGGGTCCCGCCGGGCTTGCCTGTGCGGATGTATTAATCCGCAACGGCGTCAATGCGGTTGTCTATGATAAACATCCTGAAATCGGTGGTCTGCTTACCTTTGGTATTCCGGCATTCAAGCTGGAAAAATCCATTATGCAGCGCCGCCGTGAATTATTCACCGAAATGGGTATTGAGTTTCATCTCAATACTGAGATCGGAAAAGATATTTCGCTCAGTGAATTACAGCAACAATATGATGCCGTGTTTATTGGTGCCGGAACCTATCAGCCGATGAACGGCGGACTACCAAATGAACAGGCTCCCGGTGTTTACAGCGCCCTGCCATACCTGATTGGTAACACACGCCATATTATGGAGCTGCCGGATGATAATTCATCGCCCTACATTGACCTGAAGAATAAGCGGGTAGTTGTGCTCGGTGGCGGAGATACCGCCATGGATTGTCTGCGCACCGCTATCCGCCAGGGCGCTGCGGATGTCACCTGCCTTTACCGTCGTGATGAAGACAATATGCCGGGCTCCCGGCGCGAAGTAAAAAATGCGAAGGAAGAAGGGGTTAATTTTCAGTTTCACTGTCAACCATCGGCCATAGAACTCAATGACCGGGGAGACGTTAGCGGAGTCCGTGTTATGGCAACGCAACTGGGCGGCACCGACAGTAACGGACGTCGTATAATTGAAACAGATAATGATTCCGCTTATACCATTGAAGCGGATGCCGTAATAATTGCCTTTGGCTTCCGTCCACACGCCATGCCCTGGCTGGATGCACTGAATATTGAACGCGACACACAGGGGCGGATCAGTGCCTCTTCACAGGCACAGTACCCGTTTGAAACCTCAGTCAGTGGCATTTTTGCAGGCGGGGATGTGGTGCGCGGCTCTGATCTTGTGGTGACCGCCATCGCGGAGGGACGCCGCGCCGCTGAAAGCATTCTCGATTATCTGCATGTTTAAACACAACAATGCGCTCTGTCATCCCAGAGCGCATTGTTAATCAGCAGAAT