Homologs in group_78

Help

11 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01590 FBDBKF_01590 100.0 Morganella morganii S1 - Trimeric autotransporter adhesin YadA-like C-terminal membrane anchor domain-containing protein
FBDBKF_06415 FBDBKF_06415 59.5 Morganella morganii S1 smc Chromosome segregation ATPase Smc
EHELCC_02060 EHELCC_02060 100.0 Morganella morganii S2 - Trimeric autotransporter adhesin YadA-like C-terminal membrane anchor domain-containing protein
EHELCC_09460 EHELCC_09460 59.5 Morganella morganii S2 smc Chromosome segregation ATPase Smc
NLDBIP_01400 NLDBIP_01400 100.0 Morganella morganii S4 - Trimeric autotransporter adhesin YadA-like C-terminal membrane anchor domain-containing protein
NLDBIP_09840 NLDBIP_09840 59.5 Morganella morganii S4 smc Chromosome segregation ATPase Smc
LHKJJB_00635 LHKJJB_00635 100.0 Morganella morganii S3 - Trimeric autotransporter adhesin YadA-like C-terminal membrane anchor domain-containing protein
LHKJJB_07915 LHKJJB_07915 59.5 Morganella morganii S3 smc Chromosome segregation ATPase Smc
HKOGLL_07465 HKOGLL_07465 59.5 Morganella morganii S5 smc Chromosome segregation ATPase Smc
F4V73_RS19530 F4V73_RS19530 58.1 Morganella psychrotolerans - YadA C-terminal domain-containing protein
PMI_RS10715 PMI_RS10715 38.9 Proteus mirabilis HI4320 - YadA-like family protein

Distribution of the homologs in the orthogroup group_78

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_78

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A0ELI2 2.19e-22 90 56 0 75 1 nadA Neisseria adhesin A Neisseria meningitidis serogroup B
P0DV44 2.5e-21 88 56 0 75 1 nadA Neisseria adhesin A Neisseria meningitidis serogroup B
Q9JXK7 1.39e-20 85 56 0 75 1 nadA Neisseria adhesin A Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0C2W0 6.88e-20 84 55 1 76 1 yadA Adhesin YadA Yersinia enterocolitica
A1JUB7 6.95e-20 84 55 1 76 1 yadA Adhesin YadA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P31489 1.26e-19 84 55 1 76 1 yadA Adhesin YadA Yersinia enterocolitica
Q9LA60 2.81e-19 82 56 1 76 1 eibA Immunoglobulin-binding protein EibA Escherichia coli
P10858 5.64e-19 82 53 1 76 1 yadA Adhesin YadA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q9MCI8 2.13e-18 80 53 1 76 1 eibD Immunoglobulin-binding protein EibD Escherichia coli
Q9LA56 2.3e-18 80 53 1 76 1 eibC Immunoglobulin-binding protein EibC Escherichia coli
Q9LA53 2.42e-17 77 56 1 76 1 eibE Immunoglobulin-binding protein EibE Escherichia coli

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_00675
Feature type CDS
Gene -
Product Trimeric autotransporter adhesin YadA-like C-terminal membrane anchor domain-containing protein
Location 118374 - 118604 (strand: -1)
Length 231 (nucleotides) / 76 (amino acids)
In genomic island -

Contig

Accession ZDB_679
Length 398279 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_78
Orthogroup size 12
N. genomes 7

Actions

Genomic region

Domains

PF03895 YadA-like membrane anchor domain

Protein Sequence

MQRGFAMSAATSNLFQPYNIGKFNLSAAVGGYNSENAVAVGSGYRFNEYVAVKASLATSTSNGGDVMYGAGMNLEW

Flanking regions ( +/- flanking 50bp)

CGGCCCGTATTGATAAACTGGAGCTGCGTTATGATGAGCTGAATGACAAGATGCAGCGCGGCTTTGCAATGTCAGCCGCCACGTCAAACCTGTTCCAGCCGTATAATATCGGTAAATTTAACCTCAGTGCAGCTGTCGGCGGATATAACTCCGAAAATGCGGTTGCTGTCGGCAGCGGCTACCGTTTCAATGAATATGTGGCAGTTAAAGCCAGCCTGGCAACCTCAACATCAAACGGCGGTGATGTCATGTATGGTGCCGGTATGAACCTGGAGTGGTAACACACCGGCATATACGGGATAACATATTTTTATAGTGAAGAGCCGGTAAG