Homologs in group_2288

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_17255 EHELCC_17255 100.0 Morganella morganii S2 dxs 1-deoxy-D-xylulose-5-phosphate synthase
NLDBIP_17940 NLDBIP_17940 100.0 Morganella morganii S4 dxs 1-deoxy-D-xylulose-5-phosphate synthase
LHKJJB_17860 LHKJJB_17860 100.0 Morganella morganii S3 dxs 1-deoxy-D-xylulose-5-phosphate synthase
HKOGLL_17870 HKOGLL_17870 100.0 Morganella morganii S5 dxs 1-deoxy-D-xylulose-5-phosphate synthase
F4V73_RS16535 F4V73_RS16535 96.6 Morganella psychrotolerans dxs 1-deoxy-D-xylulose-5-phosphate synthase
PMI_RS00450 PMI_RS00450 83.4 Proteus mirabilis HI4320 dxs 1-deoxy-D-xylulose-5-phosphate synthase

Distribution of the homologs in the orthogroup group_2288

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2288

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EU31 0.0 1090 83 0 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Proteus mirabilis (strain HI4320)
A8GAP2 0.0 1079 82 0 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Serratia proteamaculans (strain 568)
Q7N0J7 0.0 1079 82 0 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B7LMG7 0.0 1073 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q66DV4 0.0 1072 81 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K6T7 0.0 1072 81 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
P77488 0.0 1071 81 0 620 1 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli (strain K12)
B1XF08 0.0 1071 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli (strain K12 / DH10B)
C4ZTH7 0.0 1071 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli (strain K12 / MC4100 / BW2952)
Q325I1 0.0 1071 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shigella boydii serotype 4 (strain Sb227)
B2U4M3 0.0 1071 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RFC0 0.0 1071 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli (strain UTI89 / UPEC)
A1A890 0.0 1071 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O1:K1 / APEC
B7MD78 0.0 1071 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
B1JID8 0.0 1070 81 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FLE4 0.0 1070 81 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q8FKB9 0.0 1070 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MQD5 0.0 1070 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O81 (strain ED1a)
B7NJ77 0.0 1070 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B1LJH0 0.0 1069 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli (strain SMS-3-5 / SECEC)
B7N8X3 0.0 1069 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B6HZM1 0.0 1069 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli (strain SE11)
B1J029 0.0 1069 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZX72 0.0 1069 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O9:H4 (strain HS)
B7M3Q9 0.0 1069 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O8 (strain IAI1)
B5Z3S5 0.0 1069 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XE76 0.0 1069 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O157:H7
A7ZIH3 0.0 1069 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q32JH8 0.0 1068 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shigella dysenteriae serotype 1 (strain Sd197)
Q3Z4Y9 0.0 1067 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shigella sonnei (strain Ss046)
Q83SG2 0.0 1067 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shigella flexneri
A9MM42 0.0 1067 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B7UJP3 0.0 1067 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7L654 0.0 1066 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli (strain 55989 / EAEC)
A4TPG2 0.0 1065 81 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia pestis (strain Pestoides F)
Q1CL87 0.0 1065 81 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9QZS3 0.0 1065 81 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZC45 0.0 1065 81 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia pestis
Q1C4I9 0.0 1065 81 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia pestis bv. Antiqua (strain Antiqua)
Q0TKM1 0.0 1064 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8ZRD1 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TMA2 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella schwarzengrund (strain CVM19633)
C0Q7U7 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella paratyphi C (strain RKS4594)
A9MX09 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SWR4 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella newport (strain SL254)
B5R6S3 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QTH0 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella enteritidis PT4 (strain P125109)
B5FKS7 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella dublin (strain CT_02021853)
Q57SE2 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella choleraesuis (strain SC-B67)
B4T8R3 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella heidelberg (strain SL476)
Q8Z8X3 0.0 1062 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella typhi
B5EXG3 0.0 1061 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella agona (strain SL483)
A4W791 0.0 1060 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Enterobacter sp. (strain 638)
A1JNR7 0.0 1060 80 1 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B5BDB0 0.0 1060 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella paratyphi A (strain AKU_12601)
Q5PFR6 0.0 1060 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A8AK34 0.0 1060 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
C6DB37 0.0 1057 80 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D844 0.0 1055 80 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C5BCH9 0.0 1045 80 0 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Edwardsiella ictaluri (strain 93-146)
A7MFG0 0.0 1045 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Cronobacter sakazakii (strain ATCC BAA-894)
B5Y0X1 0.0 1044 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Klebsiella pneumoniae (strain 342)
A6T5F3 0.0 1039 80 0 620 1 dxs 1-deoxy-D-xylulose-5-phosphate synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q2NV94 0.0 1014 78 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Sodalis glossinidius (strain morsitans)
B2VHS3 0.0 1012 76 0 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6LU07 0.0 983 75 2 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Photobacterium profundum (strain SS9)
B7VJA1 0.0 971 74 3 628 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Vibrio atlanticus (strain LGP32)
C4K6M7 0.0 969 74 1 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A7MYC6 0.0 965 74 2 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Vibrio campbellii (strain ATCC BAA-1116)
C3LTD9 0.0 963 74 3 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Vibrio cholerae serotype O1 (strain M66-2)
Q9KTL3 0.0 963 74 3 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F331 0.0 963 74 3 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q87RU0 0.0 959 74 2 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MN49 0.0 947 73 2 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Vibrio vulnificus (strain YJ016)
Q8DFA3 0.0 947 73 2 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Vibrio vulnificus (strain CMCP6)
Q5E6Z0 0.0 945 72 3 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FBG6 0.0 942 71 3 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Aliivibrio fischeri (strain MJ11)
B6EIA7 0.0 941 71 3 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Aliivibrio salmonicida (strain LFI1238)
Q1LTI9 0.0 940 71 2 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
A4SJP9 0.0 938 72 2 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Aeromonas salmonicida (strain A449)
A0KNF9 0.0 932 71 2 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
P57848 0.0 930 71 3 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pasteurella multocida (strain Pm70)
B0UUA4 0.0 919 70 3 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Histophilus somni (strain 2336)
Q0I3G1 0.0 919 70 3 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Histophilus somni (strain 129Pt)
A1RLV3 0.0 917 70 1 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella sp. (strain W3-18-1)
A4Y4X0 0.0 917 70 1 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A3D2B2 0.0 916 70 1 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A5UEV6 0.0 916 69 3 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Haemophilus influenzae (strain PittGG)
B1KQY8 0.0 915 70 1 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella woodyi (strain ATCC 51908 / MS32)
A6WL04 0.0 915 70 1 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella baltica (strain OS185)
B8EAU7 0.0 915 70 1 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella baltica (strain OS223)
A9KTL5 0.0 914 70 1 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella baltica (strain OS195)
P45205 0.0 914 69 3 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B0TQ36 0.0 914 70 1 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella halifaxensis (strain HAW-EB4)
A5UC51 0.0 913 69 3 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Haemophilus influenzae (strain PittEE)
Q4QKG6 0.0 912 69 3 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Haemophilus influenzae (strain 86-028NP)
A8H6X1 0.0 910 70 1 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A3QGN9 0.0 909 69 1 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A8FYL0 0.0 909 70 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella sediminis (strain HAW-EB3)
B8F3A4 0.0 908 71 3 609 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Glaesserella parasuis serovar 5 (strain SH0165)
B8CS19 0.0 906 70 1 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
A1S8D4 0.0 905 70 1 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q07ZD4 0.0 905 68 1 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella frigidimarina (strain NCIMB 400)
Q65TP4 0.0 904 68 3 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q0HSW6 0.0 900 70 1 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella sp. (strain MR-7)
Q0HGL5 0.0 900 70 1 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella sp. (strain MR-4)
Q8EGR9 0.0 899 70 1 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A0KZA9 0.0 898 70 1 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella sp. (strain ANA-3)
Q487D3 0.0 896 67 3 630 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q12L26 0.0 894 67 1 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B0BSL0 0.0 892 69 3 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H050 0.0 892 69 3 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MYS9 0.0 892 69 3 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q3II09 0.0 884 67 2 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudoalteromonas translucida (strain TAC 125)
Q7VNP7 0.0 880 67 3 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B4RVY8 0.0 863 66 3 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A1SWW6 0.0 862 65 3 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q493G7 0.0 860 66 2 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Blochmanniella pennsylvanica (strain BPEN)
Q15W93 0.0 856 66 2 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q5QVE8 0.0 852 65 3 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q8D357 0.0 838 64 1 613 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Wigglesworthia glossinidia brevipalpis
Q7VRH9 0.0 806 61 6 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Blochmanniella floridana
Q1IFL1 0.0 788 61 2 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas entomophila (strain L48)
Q7NUK5 0.0 787 62 3 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A4XZ25 0.0 786 61 2 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas mendocina (strain ymp)
Q88QG7 0.0 785 60 3 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KL79 0.0 785 60 3 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas putida (strain GB-1)
A5VXW9 0.0 785 60 3 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B1J3G4 0.0 784 60 2 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas putida (strain W619)
C1DAW8 0.0 782 61 2 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Laribacter hongkongensis (strain HLHK9)
A4VQS8 0.0 781 61 2 613 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Stutzerimonas stutzeri (strain A1501)
Q60AN1 0.0 781 62 3 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8K9A1 0.0 780 59 3 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B8D7Z3 0.0 778 60 5 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D9P1 0.0 778 60 5 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q0A8V7 0.0 778 60 4 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q2YCH7 0.0 778 59 3 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
P57536 0.0 776 60 5 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8GN62 0.0 775 60 2 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A6V058 0.0 774 60 4 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas aeruginosa (strain PA7)
Q2SA08 0.0 774 60 3 613 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Hahella chejuensis (strain KCTC 2396)
Q48NX0 0.0 772 60 2 613 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q889Q1 0.0 772 60 3 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZYU8 0.0 771 60 2 613 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas syringae pv. syringae (strain B728a)
C3K2R1 0.0 769 61 3 609 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas fluorescens (strain SBW25)
Q3K660 0.0 767 60 4 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas fluorescens (strain Pf0-1)
Q9KGU7 0.0 764 60 4 614 1 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02SL1 0.0 764 60 4 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V7R4 0.0 764 60 4 614 1 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas aeruginosa (strain LESB58)
Q82VD3 0.0 761 59 3 610 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q4K5A5 0.0 761 59 3 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3JAD1 0.0 759 57 4 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q0AFY6 0.0 758 57 3 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A0AYZ0 0.0 750 58 5 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia cenocepacia (strain HI2424)
Q1BLY7 0.0 750 58 5 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia orbicola (strain AU 1054)
B1K3S9 0.0 750 58 5 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia orbicola (strain MC0-3)
Q21UG7 0.0 749 58 2 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q1GZD7 0.0 748 57 3 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B4EN29 0.0 747 58 4 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q393P4 0.0 746 57 5 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BAL8 0.0 746 57 5 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1Z1G2 0.0 746 57 5 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia ambifaria (strain MC40-6)
Q13RX1 0.0 745 58 5 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Paraburkholderia xenovorans (strain LB400)
A6VUE5 0.0 741 58 6 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Marinomonas sp. (strain MWYL1)
B3PF22 0.0 741 55 3 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Cellvibrio japonicus (strain Ueda107)
Q3SKF1 0.0 740 58 3 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thiobacillus denitrificans (strain ATCC 25259)
A1TNR1 0.0 738 58 2 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Paracidovorax citrulli (strain AAC00-1)
B2JP68 0.0 736 57 5 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B9MEU8 0.0 735 58 2 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Acidovorax ebreus (strain TPSY)
A1K4R0 0.0 735 56 2 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Azoarcus sp. (strain BH72)
Q2KZ15 0.0 733 57 4 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bordetella avium (strain 197N)
Q8PJG7 0.0 731 56 4 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xanthomonas axonopodis pv. citri (strain 306)
Q8P815 0.0 731 56 4 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UW29 0.0 731 56 4 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xanthomonas campestris pv. campestris (strain 8004)
Q12CQ9 0.0 729 57 4 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q5H1A0 0.0 728 56 4 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQV8 0.0 728 56 4 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P472 0.0 728 56 4 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B3R5H4 0.0 728 57 5 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q2T7N5 0.0 728 57 5 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63JF4 0.0 728 57 5 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia pseudomallei (strain K96243)
Q3JKA3 0.0 728 57 5 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia pseudomallei (strain 1710b)
A3P7W4 0.0 728 57 5 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia pseudomallei (strain 1106a)
Q62DU1 0.0 728 57 5 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia mallei (strain ATCC 23344)
Q7W7Q0 0.0 728 56 3 604 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WL37 0.0 728 56 3 604 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A3NMF6 0.0 726 57 5 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia pseudomallei (strain 668)
Q5P228 0.0 726 56 3 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A1VMD7 0.0 726 57 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Polaromonas naphthalenivorans (strain CJ2)
Q7VV87 0.0 726 56 3 604 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q1LK34 0.0 723 56 5 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B1Y2X5 0.0 722 56 4 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A2SJ46 0.0 721 56 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A0Q6B9 0.0 720 55 4 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Francisella tularensis subsp. novicida (strain U112)
A1W4U9 0.0 719 57 2 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Acidovorax sp. (strain JS42)
A4IXW5 0.0 719 55 4 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NG39 0.0 719 55 4 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14HJ1 0.0 719 55 4 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Francisella tularensis subsp. tularensis (strain FSC 198)
Q0BLU9 0.0 718 55 4 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A3D3 0.0 718 55 4 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Francisella tularensis subsp. holarctica (strain LVS)
A7NCA4 0.0 718 55 4 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B2FN57 0.0 717 58 5 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Stenotrophomonas maltophilia (strain K279a)
Q474C2 0.0 715 55 5 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B2SGK5 0.0 714 55 4 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Francisella tularensis subsp. mediasiatica (strain FSC147)
B0U0B3 0.0 713 54 4 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q47BJ0 0.0 712 55 2 608 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Dechloromonas aromatica (strain RCB)
Q0VMI4 0.0 712 55 4 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B2U930 0.0 712 55 5 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Ralstonia pickettii (strain 12J)
Q3BRW8 0.0 710 56 4 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q0K860 0.0 709 56 5 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q87C03 0.0 706 54 5 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I607 0.0 706 54 5 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xylella fastidiosa (strain M23)
B0U3E1 0.0 705 54 5 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xylella fastidiosa (strain M12)
Q8XX95 0.0 704 54 6 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q9PB95 0.0 703 54 5 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xylella fastidiosa (strain 9a5c)
A9ITB0 0.0 703 56 4 613 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q9JXV7 0.0 696 54 6 628 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q1R1E5 0.0 696 54 5 633 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A1KS32 0.0 694 54 7 629 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A1WN06 0.0 694 55 3 609 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Verminephrobacter eiseniae (strain EF01-2)
Q9JW13 0.0 693 53 6 628 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M1G3 0.0 693 53 6 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Neisseria meningitidis serogroup C (strain 053442)
Q5FAI2 0.0 692 54 6 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B4RNW6 0.0 690 53 6 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Neisseria gonorrhoeae (strain NCCP11945)
Q21F93 0.0 687 54 3 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B0V710 0.0 647 50 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Acinetobacter baumannii (strain AYE)
B0VQB8 0.0 647 51 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Acinetobacter baumannii (strain SDF)
Q6F7N5 0.0 642 50 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A0L6H3 0.0 637 51 7 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
B0CKC0 0.0 633 51 6 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella suis (strain ATCC 23445 / NCTC 10510)
B6IRB5 0.0 628 52 6 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodospirillum centenum (strain ATCC 51521 / SW)
O67036 0.0 625 50 7 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Aquifex aeolicus (strain VF5)
Q11KE0 0.0 624 51 6 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chelativorans sp. (strain BNC1)
Q39RT4 0.0 624 48 6 623 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A5VP09 0.0 623 51 6 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A6WWC4 0.0 621 51 6 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q8G292 0.0 620 51 6 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella suis biovar 1 (strain 1330)
Q8YFM2 0.0 620 51 6 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RHE3 0.0 620 51 6 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M8W0 0.0 620 51 6 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q5NM38 0.0 619 50 7 628 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q74FC3 0.0 619 49 6 605 3 dxs1 1-deoxy-D-xylulose-5-phosphate synthase 1 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q57ET1 0.0 619 50 6 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella abortus biovar 1 (strain 9-941)
B2S9T6 0.0 619 50 6 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella abortus (strain S19)
Q2YMF0 0.0 617 50 6 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella abortus (strain 2308)
Q5NN52 0.0 616 50 7 626 3 dxs1 1-deoxy-D-xylulose-5-phosphate synthase 1 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q985Y3 0.0 615 52 6 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q130G7 0.0 610 51 7 629 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodopseudomonas palustris (strain BisB5)
Q6G0D4 0.0 608 50 7 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bartonella quintana (strain Toulouse)
Q6G4D1 0.0 607 50 7 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q89RW1 0.0 607 50 7 629 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q2IRL7 0.0 607 50 7 629 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodopseudomonas palustris (strain HaA2)
A1URW6 0.0 606 51 8 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q8RAC5 0.0 605 48 5 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B3QFY7 0.0 605 50 7 630 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodopseudomonas palustris (strain TIE-1)
Q6NB76 0.0 605 50 7 630 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A9IQP2 0.0 604 50 7 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q3A3Z6 0.0 604 49 7 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q21A74 0.0 604 50 7 630 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodopseudomonas palustris (strain BisB18)
Q07SR3 0.0 602 50 7 630 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodopseudomonas palustris (strain BisA53)
A4YQ36 0.0 602 49 7 629 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bradyrhizobium sp. (strain ORS 278)
A8IBS1 0.0 601 50 6 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A5V6A9 0.0 600 49 6 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q3SUZ1 0.0 600 50 7 631 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q2LUA7 0.0 600 47 7 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Syntrophus aciditrophicus (strain SB)
Q1QE74 0.0 599 47 11 644 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A5EEQ0 0.0 599 49 7 629 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q1QQ40 0.0 599 50 7 631 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q0ARE5 0.0 597 49 7 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Maricaulis maris (strain MCS10)
Q2GC13 0.0 596 49 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B2A526 0.0 596 48 5 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B1I3J6 0.0 596 48 6 610 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Desulforudis audaxviator (strain MP104C)
Q0AZE2 0.0 596 48 6 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A7IPK6 0.0 595 50 8 630 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q92RJ1 0.0 594 49 6 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhizobium meliloti (strain 1021)
Q8KFI9 0.0 594 49 6 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q74CB0 0.0 592 49 7 620 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q4FN07 0.0 591 49 7 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pelagibacter ubique (strain HTCC1062)
B2IDK3 0.0 591 50 6 629 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B4RGW0 0.0 590 49 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Phenylobacterium zucineum (strain HLK1)
Q2KBR2 0.0 589 48 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PS68 0.0 588 48 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhizobium etli (strain CIAT 652)
Q4FV64 0.0 587 47 12 643 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B5ZS68 0.0 586 47 6 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q8UHD7 0.0 585 48 7 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q1MKN4 0.0 584 47 6 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B0T3X7 0.0 583 49 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Caulobacter sp. (strain K31)
B9JSL2 0.0 583 49 7 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q2N6U5 0.0 582 48 6 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Erythrobacter litoralis (strain HTCC2594)
Q1GQK9 0.0 580 49 9 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q5FUB1 0.0 578 48 10 635 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Gluconobacter oxydans (strain 621H)
Q3B5P3 0.0 578 48 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q3AAN0 0.0 578 45 4 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q39UB1 0.0 578 47 5 620 3 dxs1 1-deoxy-D-xylulose-5-phosphate synthase 1 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B9JAL7 0.0 577 47 6 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A7H9E8 0.0 577 47 8 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Anaeromyxobacter sp. (strain Fw109-5)
B9L1L6 0.0 575 47 6 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
Q2RYD6 0.0 574 47 8 623 3 dxs1 1-deoxy-D-xylulose-5-phosphate synthase 1 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q3J1A8 0.0 574 48 6 624 3 dxs1 1-deoxy-D-xylulose-5-phosphate synthase 1 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q2RR29 0.0 573 47 8 623 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B8GXC4 0.0 572 48 6 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A6M5 0.0 572 48 6 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A5D2Z6 0.0 570 45 6 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q2IPZ2 0.0 570 47 6 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Anaeromyxobacter dehalogenans (strain 2CP-C)
B0TEJ5 0.0 569 46 6 613 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q16CP0 0.0 569 47 9 639 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q3IYR6 0.0 569 47 7 617 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
B4UHF5 0.0 566 47 6 610 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Anaeromyxobacter sp. (strain K)
Q1GCG4 0.0 566 47 9 632 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Ruegeria sp. (strain TM1040)
Q5LX42 0.0 565 47 7 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B8JFY1 0.0 564 47 6 610 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
C0ZC10 0.0 562 46 6 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q6AJQ1 0.0 560 46 9 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q28WA7 0.0 560 47 8 623 3 dxs1 1-deoxy-D-xylulose-5-phosphate synthase 1 Jannaschia sp. (strain CCS1)
A4IQR7 0.0 559 45 5 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Geobacillus thermodenitrificans (strain NG80-2)
B8D2I3 0.0 558 45 6 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q28W25 0.0 558 46 6 626 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Jannaschia sp. (strain CCS1)
A0A803PDZ0 0.0 558 46 9 638 2 DXS2 1-deoxy-D-xylulose-5-phosphate synthase 2, chloroplastic Cannabis sativa
C5D467 0.0 556 45 5 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Geobacillus sp. (strain WCH70)
Q11NY7 0.0 554 45 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q75TB7 0.0 553 46 6 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Geobacillus kaustophilus (strain HTA426)
Q2W367 0.0 553 50 7 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A4SDG1 0.0 552 46 5 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A1VE69 0.0 551 46 7 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nitratidesulfovibrio vulgaris (strain DP4)
Q72CD3 0.0 551 46 7 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q30Z99 0.0 551 45 7 630 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q2RIB9 0.0 549 47 6 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q38854 0.0 549 47 10 634 1 DXS 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic Arabidopsis thaliana
O22567 0.0 548 46 10 642 2 CLA1 1-deoxy-D-xylulose-5-phosphate synthase 1, chloroplastic Oryza sativa subsp. japonica
Q7NP63 0.0 548 46 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q6YU51 0.0 548 47 10 639 2 Os07g0190000 Probable 1-deoxy-D-xylulose-5-phosphate synthase 2, chloroplastic Oryza sativa subsp. japonica
B8E247 0.0 546 45 8 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
B8HWL8 0.0 546 46 7 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q0C154 0.0 546 48 7 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Hyphomonas neptunium (strain ATCC 15444)
Q9K971 0.0 545 44 6 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q10ZY2 0.0 544 46 7 629 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Trichodesmium erythraeum (strain IMS101)
P73067 0.0 543 46 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B1WWM7 0.0 543 44 6 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q3M4F6 0.0 541 44 7 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q92BZ0 0.0 541 44 5 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B5YE06 0.0 541 44 8 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
A0A7J6EK66 0.0 541 47 10 635 2 DXS1 1-deoxy-D-xylulose-5-phosphate synthase 1, chloroplastic Cannabis sativa
O78328 0.0 540 47 10 635 2 TKT2 Probable 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic Capsicum annuum
Q24V05 0.0 540 45 7 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Desulfitobacterium hafniense (strain Y51)
A0AIG6 0.0 540 44 5 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B8FQ45 0.0 540 45 7 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q2JTX2 0.0 539 46 9 631 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechococcus sp. (strain JA-3-3Ab)
B7JVJ6 0.0 538 45 6 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q8YZ80 0.0 538 44 7 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B2J5P1 0.0 538 44 7 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
B7KAF7 0.0 538 45 6 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Gloeothece citriformis (strain PCC 7424)
P26242 0.0 537 46 6 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodobacter capsulatus
A6L175 0.0 536 43 7 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A9VGD1 0.0 536 43 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus mycoides (strain KBAB4)
Q6HDY8 0.0 536 43 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q635A7 0.0 536 43 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus cereus (strain ZK / E33L)
B7JM28 0.0 536 43 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus cereus (strain AH820)
Q81M54 0.0 536 43 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus anthracis
C3LJV1 0.0 536 43 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P7V6 0.0 536 43 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus anthracis (strain A0248)
B7HNU0 0.0 535 43 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus cereus (strain AH187)
Q731B7 0.0 535 43 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q16DV7 0.0 534 45 9 633 3 dxs1 1-deoxy-D-xylulose-5-phosphate synthase 1 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q818R9 0.0 534 43 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HB48 0.0 534 43 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus cereus (strain B4264)
B0JL88 0.0 533 45 7 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
A7Z6J5 0.0 533 44 5 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A8FF11 0.0 533 43 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus pumilus (strain SAFR-032)
A5GTT4 0.0 533 45 8 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechococcus sp. (strain RCC307)
B7IXG8 0.0 533 43 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus cereus (strain G9842)
A8MFI7 0.0 532 45 7 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Alkaliphilus oremlandii (strain OhILAs)
P54523 0.0 531 45 5 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus subtilis (strain 168)
Q2JK64 0.0 530 45 8 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechococcus sp. (strain JA-2-3B'a(2-13))
B1HRX4 0.0 529 44 5 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Lysinibacillus sphaericus (strain C3-41)
Q65HJ2 0.0 529 44 5 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A7GSJ5 0.0 529 43 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A2C220 2.17e-180 528 45 7 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain NATL1A)
A0Q0A4 2.21e-180 527 44 9 613 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium novyi (strain NT)
B0C8J3 3.42e-180 527 44 7 630 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Acaryochloris marina (strain MBIC 11017)
Q46L36 4.16e-180 527 45 7 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain NATL2A)
B2RMK4 7.31e-180 526 43 5 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q8XJE1 7.78e-180 526 43 5 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium perfringens (strain 13 / Type A)
Q7MSZ3 8.79e-180 526 43 5 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
A6LFB9 1.3e-179 526 43 7 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A8G4R9 1.63e-179 525 44 8 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain MIT 9215)
Q67NB6 3.6e-179 525 44 7 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B1YLQ5 4.19e-179 524 44 5 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q0TPD8 4.72e-179 524 43 5 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A2BR27 6.61e-179 524 43 8 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain AS9601)
Q5WF63 7.62e-179 523 44 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shouchella clausii (strain KSM-K16)
Q8GAA0 1.05e-178 523 44 8 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q1IZP0 1.23e-178 523 45 6 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q8DL74 1.49e-178 523 45 6 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B1XKC5 1.8e-178 523 44 7 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
A5FRB9 2.83e-178 522 43 8 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q3ZXC2 4.09e-178 522 43 8 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Dehalococcoides mccartyi (strain CBDB1)
Q0SS05 5.25e-178 521 43 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium perfringens (strain SM101 / Type A)
A3PCV0 6.18e-178 521 43 8 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain MIT 9301)
Q9R6S7 6.32e-178 521 44 8 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31AZ2 1.03e-177 521 43 8 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain MIT 9312)
Q3Z8G9 2.08e-177 521 43 8 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q97HD5 2.25e-177 520 42 6 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q7V1G6 3.54e-177 520 43 8 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q64Y02 6.15e-177 520 42 6 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacteroides fragilis (strain YCH46)
Q5LH44 6.15e-177 520 42 6 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q71ZV7 8.99e-177 518 44 7 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Listeria monocytogenes serotype 4b (strain F2365)
C1L2S1 8.99e-177 518 44 7 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q8Y7C1 1.23e-176 517 44 7 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8F153 2.01e-176 518 42 3 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72U01 2.01e-176 518 42 3 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q8A0C2 3.6e-176 518 43 7 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q053M2 3.81e-176 517 42 4 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04U59 3.81e-176 517 42 4 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
A9BAC1 1.81e-175 515 44 7 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain MIT 9211)
Q9RUB5 2.49e-175 514 45 5 608 1 dxs 1-deoxy-D-xylulose-5-phosphate synthase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q0IAA6 3.96e-175 515 44 10 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechococcus sp. (strain CC9311)
C1F3C4 1.19e-174 513 42 6 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
B2V4R3 1.43e-174 512 43 5 608 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium botulinum (strain Alaska E43 / Type E3)
B9E6Q6 1.49e-174 513 43 5 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Macrococcus caseolyticus (strain JCSC5402)
A2BWN6 2.02e-174 512 43 8 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain MIT 9515)
A9KMB8 2.86e-174 512 42 5 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
B3DW88 3.33e-174 512 42 6 609 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Methylacidiphilum infernorum (isolate V4)
Q18B68 3.55e-174 511 42 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridioides difficile (strain 630)
A5N7J2 6.73e-174 511 42 5 603 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E104 6.73e-174 511 42 5 603 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium kluyveri (strain NBRC 12016)
A5GL34 1.22e-173 511 44 12 630 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechococcus sp. (strain WH7803)
B2TRM5 2.29e-173 509 43 6 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium botulinum (strain Eklund 17B / Type B)
Q894H0 7.32e-173 508 41 5 606 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium tetani (strain Massachusetts / E88)
Q7VC14 2.22e-172 508 43 10 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q1MRB3 2.54e-172 507 43 8 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Lawsonia intracellularis (strain PHE/MN1-00)
Q3AJP8 5.29e-172 506 44 9 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechococcus sp. (strain CC9605)
Q3AXZ4 8.25e-172 506 43 10 629 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechococcus sp. (strain CC9902)
Q5SMD7 1.05e-171 505 45 7 608 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72H81 4.76e-171 503 46 8 608 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A6LU48 5.08e-171 503 42 5 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A5ILK2 1.64e-170 501 43 7 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q7V7Q3 9.55e-166 491 43 10 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain MIT 9313)
Q9X291 9.94e-166 489 43 5 608 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B1LAQ3 1.67e-165 489 43 5 608 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thermotoga sp. (strain RQ2)
Q7U6P6 4.16e-165 489 44 11 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Parasynechococcus marenigrum (strain WH8102)
B6YRV5 5.33e-165 488 39 6 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Azobacteroides pseudotrichonymphae genomovar. CFP2
A2C9X1 2.71e-164 487 43 11 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain MIT 9303)
Q6MDK6 8.18e-162 480 40 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Protochlamydia amoebophila (strain UWE25)
B2S462 1.56e-159 474 41 9 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Treponema pallidum subsp. pallidum (strain SS14)
O83796 1.56e-159 474 41 9 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Treponema pallidum (strain Nichols)
A8L0K9 3.92e-158 471 39 8 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Parafrankia sp. (strain EAN1pec)
Q73LF4 2.13e-156 467 38 9 639 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
A0RMN5 3.05e-156 465 39 5 601 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Campylobacter fetus subsp. fetus (strain 82-40)
Q2JDD9 1.9e-155 464 39 7 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
A8EWN0 6.74e-153 456 39 7 603 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Aliarcobacter butzleri (strain RM4018)
O25121 5.05e-151 452 40 7 599 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Helicobacter pylori (strain ATCC 700392 / 26695)
Q1CUF6 5.27e-151 452 40 7 599 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Helicobacter pylori (strain HPAG1)
B5ZAB7 5.75e-151 452 40 7 599 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Helicobacter pylori (strain G27)
Q9ZM94 7.45e-151 452 40 7 599 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Helicobacter pylori (strain J99 / ATCC 700824)
Q5HWF0 4.04e-150 449 39 6 602 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Campylobacter jejuni (strain RM1221)
Q9PIH8 5.7e-150 449 39 6 599 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A1VY40 6.02e-150 449 39 6 599 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A8FKB0 6.71e-150 449 39 6 599 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q47NL9 3.7e-149 448 39 11 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thermobifida fusca (strain YX)
A7H552 5.22e-149 447 39 7 605 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q7VIJ7 8.14e-149 447 38 8 635 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q9Z6J9 3.88e-148 446 38 9 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlamydia pneumoniae
Q30TC5 4.89e-148 444 39 8 601 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q7UWB7 5.39e-148 445 38 7 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A6Q1Z6 2.75e-147 442 39 5 597 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nitratiruptor sp. (strain SB155-2)
A7I2V7 4.81e-146 439 39 7 594 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q7M7Z0 8.19e-146 439 39 8 607 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q9F1V2 1.07e-145 439 39 9 623 3 dxs1 1-deoxy-D-xylulose-5-phosphate synthase 1 Kitasatospora griseola
B1MCU7 1.83e-145 439 38 10 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
A0QW19 5.83e-145 437 38 10 636 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q0S1H1 1.57e-144 436 37 8 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodococcus jostii (strain RHA1)
Q8CJP7 3.28e-144 435 38 11 627 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
C0ZYV9 4.43e-144 435 38 10 628 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q4JVB5 1.22e-142 431 39 10 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Corynebacterium jeikeium (strain K411)
Q1D3G4 2.92e-142 428 41 8 607 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Myxococcus xanthus (strain DK1622)
Q9RBN6 8.47e-142 429 38 11 620 1 dxs 1-deoxy-D-xylulose-5-phosphate synthase Streptomyces sp. (strain CL190)
B1VWJ8 9.32e-142 429 38 11 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q8VUR8 1.24e-141 428 38 11 629 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Kitasatospora griseola
Q5L6H4 1.44e-141 429 37 9 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlamydia abortus (strain DSM 27085 / S26/3)
Q50000 1.91e-141 428 38 9 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium leprae (strain TN)
B8ZQW9 1.91e-141 428 38 9 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium leprae (strain Br4923)
Q82KW8 2.83e-141 428 37 11 627 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P9WNS3 7.13e-141 427 37 7 623 1 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNS2 7.13e-141 427 37 7 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U634 7.13e-141 427 37 7 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AFE1 7.13e-141 427 37 7 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KM20 7.13e-141 427 37 7 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A555 7.13e-141 427 37 7 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q1B9W8 8.47e-141 426 38 9 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium sp. (strain MCS)
A1UF44 8.47e-141 426 38 9 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium sp. (strain KMS)
Q3KM28 4.48e-140 425 36 9 630 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B0BBW4 4.62e-140 425 36 9 630 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B7P9 4.62e-140 425 36 9 630 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
O84335 5.15e-140 424 36 9 630 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
A3PYK6 6.7e-140 424 38 9 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium sp. (strain JLS)
Q9PK62 7.48e-140 424 37 8 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlamydia muridarum (strain MoPn / Nigg)
Q9X7W3 1.74e-139 424 38 10 621 3 dxs1 1-deoxy-D-xylulose-5-phosphate synthase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q5YTA2 8.38e-139 421 37 8 632 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nocardia farcinica (strain IFM 10152)
Q73W57 1.61e-137 418 37 7 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QIL6 1.76e-137 418 37 7 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium avium (strain 104)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_17360
Feature type CDS
Gene dxs
Product 1-deoxy-D-xylulose-5-phosphate synthase
Location 2630 - 4498 (strand: 1)
Length 1869 (nucleotides) / 622 (amino acids)
In genomic island -

Contig

Accession contig_28
Length 42791 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2288
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02779 Transketolase, pyrimidine binding domain
PF02780 Transketolase, C-terminal domain
PF13292 1-deoxy-D-xylulose-5-phosphate synthase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1154 Coenzyme transport and metabolism (H)
Lipid transport and metabolism (I)
HI Deoxyxylulose-5-phosphate synthase

Kegg Ortholog Annotation(s)

Protein Sequence

MSIDIAKYPTLALVETPDDLRLLPKESLPKLCDELRQYLLNSVSRSSGHFASGLGTIELTVALHYVYQTPFDNLIWDVGHQAYPHKILTGRRDRIDTIRHKNGLHAFPWREESEYDVLSVGHSSTSISAGVGMAVAAAREGRNRKTVCVIGDGAITAGMAFEAMNHGGDIKSDMLVILNDNEMSISENVGALNNHLAQLLSGKLYTTLREGGKKVFSGLPPIKDLLKKTEEHIKGMVVPSTFFEELGFNYIGPVDGHDVLALIQTLKNMRDLKGPQFLHIMTKKGRGYEPAEKDPISWHAVPQFDPSTGTLPKSKSSKPTFSKIFGDWLCEEAEHDPKLMAITPAMREGSGMVRFSKSFPDQYFDVAIAEQHSVTFAAGLAIGGYKPVVAIYSSFLQRAYDQVIHDVAIQKLPVLFAIDRAGIVGNDGPTHQGAFDLSFLRILPNMVIMTPSDENECRQMLHTGYHYGKGPVAVRYPRGGGCGATLQPLTQIEIGKGVVRREGEKTAILVFGTLLEEVLKAAENLNATVVDMRFVKPLDEALILEMAARHDTLVTVEENAVMGGAGSGVNEFLMAQRKPVPVLNIGLPDSYVPQGDQEEIRSDMGLDAEHIQKSIEAYLAKA

Flanking regions ( +/- flanking 50bp)

GGCACGTTCCGGTATTTTCAGAAACTTTAATAAGAATTAGTGAGCATTACATGAGTATTGATATCGCTAAATATCCGACTTTGGCACTCGTTGAGACGCCTGATGATTTGCGTCTGTTACCGAAAGAGAGTTTACCGAAACTCTGCGATGAACTGCGGCAATATCTGTTAAACAGCGTCAGCCGTTCCAGCGGGCATTTTGCCTCCGGTCTCGGCACGATTGAACTGACCGTGGCACTCCATTATGTCTATCAGACTCCGTTTGATAACCTGATCTGGGATGTCGGCCACCAGGCCTATCCGCACAAGATCCTGACCGGGCGCCGTGACCGCATTGACACCATCCGCCATAAAAACGGGCTGCATGCTTTCCCGTGGCGTGAAGAGAGTGAATATGATGTTCTGAGTGTTGGTCACTCCTCCACCTCCATCAGTGCCGGTGTCGGGATGGCGGTTGCCGCTGCCCGTGAGGGACGCAACCGCAAAACCGTCTGTGTGATCGGCGACGGCGCGATCACCGCCGGTATGGCCTTTGAGGCAATGAACCACGGCGGGGATATCAAATCCGACATGCTGGTGATCCTCAACGACAACGAGATGTCCATCTCCGAAAACGTCGGTGCCCTCAACAACCACCTGGCGCAGCTGCTTTCCGGCAAGCTCTACACCACACTGCGTGAAGGCGGAAAGAAAGTGTTCTCCGGCCTGCCTCCTATCAAGGATCTGCTGAAGAAAACCGAAGAACACATCAAAGGCATGGTGGTGCCGAGCACCTTCTTTGAAGAGCTGGGCTTCAATTACATCGGGCCGGTAGACGGACACGATGTACTGGCACTGATCCAGACCCTGAAAAATATGCGTGACCTGAAAGGTCCTCAGTTCCTGCATATTATGACGAAAAAAGGGCGCGGTTATGAACCGGCTGAAAAAGATCCGATCAGCTGGCACGCCGTACCGCAGTTTGATCCGTCAACCGGCACACTGCCGAAAAGTAAATCGTCCAAACCGACCTTCTCAAAAATCTTCGGTGACTGGCTGTGTGAAGAAGCAGAGCACGACCCGAAACTGATGGCGATCACCCCTGCCATGCGCGAAGGTTCCGGTATGGTACGCTTCTCCAAATCCTTCCCGGATCAGTATTTTGATGTCGCGATTGCTGAACAGCACTCCGTCACCTTTGCCGCCGGACTGGCTATCGGTGGTTACAAGCCGGTTGTTGCGATTTACTCCAGCTTCCTGCAGCGCGCCTACGATCAGGTGATCCACGATGTCGCGATCCAGAAACTGCCGGTCCTGTTTGCTATCGACCGCGCCGGGATTGTCGGCAACGACGGTCCGACACACCAGGGCGCGTTTGACCTATCCTTCCTGCGCATCCTGCCGAACATGGTGATCATGACCCCGAGTGATGAAAACGAGTGCCGCCAGATGCTGCACACCGGTTATCACTACGGCAAAGGCCCGGTTGCGGTGCGTTATCCGCGCGGCGGCGGCTGTGGTGCCACACTCCAGCCACTGACTCAGATTGAGATCGGTAAAGGTGTTGTGCGCCGTGAAGGGGAGAAAACCGCAATTCTGGTCTTCGGTACCCTGCTGGAAGAAGTCCTGAAAGCAGCAGAAAACCTGAATGCCACCGTGGTGGATATGCGTTTTGTCAAACCGCTGGATGAAGCCCTGATCCTGGAGATGGCAGCGCGCCATGACACGCTGGTGACTGTCGAGGAAAACGCCGTTATGGGCGGTGCAGGCAGCGGTGTGAATGAATTCCTGATGGCACAGCGCAAGCCGGTGCCGGTGCTCAATATCGGTCTGCCGGACAGCTATGTGCCGCAGGGCGACCAGGAAGAGATCCGCAGCGATATGGGCCTGGATGCAGAGCATATTCAGAAGTCCATCGAAGCGTACCTGGCAAAAGCCTGATTATCCTTCCGGACACAAAAAACCCTGCTGATGCAGGGTTTTTTATGTCA