Homologs in group_2288

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17360 FBDBKF_17360 83.4 Morganella morganii S1 dxs 1-deoxy-D-xylulose-5-phosphate synthase
EHELCC_17255 EHELCC_17255 83.4 Morganella morganii S2 dxs 1-deoxy-D-xylulose-5-phosphate synthase
NLDBIP_17940 NLDBIP_17940 83.4 Morganella morganii S4 dxs 1-deoxy-D-xylulose-5-phosphate synthase
LHKJJB_17860 LHKJJB_17860 83.4 Morganella morganii S3 dxs 1-deoxy-D-xylulose-5-phosphate synthase
HKOGLL_17870 HKOGLL_17870 83.4 Morganella morganii S5 dxs 1-deoxy-D-xylulose-5-phosphate synthase
F4V73_RS16535 F4V73_RS16535 83.1 Morganella psychrotolerans dxs 1-deoxy-D-xylulose-5-phosphate synthase

Distribution of the homologs in the orthogroup group_2288

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2288

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EU31 0.0 1284 100 0 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Proteus mirabilis (strain HI4320)
Q7N0J7 0.0 1135 86 0 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GAP2 0.0 1090 82 0 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Serratia proteamaculans (strain 568)
Q6D844 0.0 1087 83 1 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DB37 0.0 1085 83 1 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C5BCH9 0.0 1077 82 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Edwardsiella ictaluri (strain 93-146)
B7LMG7 0.0 1068 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A4W791 0.0 1068 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Enterobacter sp. (strain 638)
Q8FKB9 0.0 1067 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MQD5 0.0 1067 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O81 (strain ED1a)
B7NJ77 0.0 1067 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5BDB0 0.0 1066 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella paratyphi A (strain AKU_12601)
Q5PFR6 0.0 1066 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5EXG3 0.0 1065 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella agona (strain SL483)
Q325I1 0.0 1065 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shigella boydii serotype 4 (strain Sb227)
B2U4M3 0.0 1065 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RFC0 0.0 1065 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli (strain UTI89 / UPEC)
B1LJH0 0.0 1065 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli (strain SMS-3-5 / SECEC)
A1A890 0.0 1065 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O1:K1 / APEC
B5Z3S5 0.0 1065 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XE76 0.0 1065 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O157:H7
B7MD78 0.0 1065 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q66DV4 0.0 1065 81 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K6T7 0.0 1065 81 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
P77488 0.0 1065 80 0 620 1 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli (strain K12)
B1XF08 0.0 1065 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli (strain K12 / DH10B)
C4ZTH7 0.0 1065 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B1JID8 0.0 1064 80 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FLE4 0.0 1064 80 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8AK34 0.0 1064 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q32JH8 0.0 1063 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shigella dysenteriae serotype 1 (strain Sd197)
B6HZM1 0.0 1063 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli (strain SE11)
B1J029 0.0 1063 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZX72 0.0 1063 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O9:H4 (strain HS)
B7M3Q9 0.0 1063 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O8 (strain IAI1)
B7UJP3 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZIH3 0.0 1063 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8ZRD1 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TMA2 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella schwarzengrund (strain CVM19633)
C0Q7U7 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella paratyphi C (strain RKS4594)
A9MX09 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SWR4 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella newport (strain SL254)
B5R6S3 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QTH0 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella enteritidis PT4 (strain P125109)
B5FKS7 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella dublin (strain CT_02021853)
Q57SE2 0.0 1063 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella choleraesuis (strain SC-B67)
B7N8X3 0.0 1063 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A1JNR7 0.0 1062 81 1 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q3Z4Y9 0.0 1062 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shigella sonnei (strain Ss046)
B4T8R3 0.0 1062 81 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella heidelberg (strain SL476)
Q8Z8X3 0.0 1061 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella typhi
B7L654 0.0 1061 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli (strain 55989 / EAEC)
Q83SG2 0.0 1061 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shigella flexneri
Q0TKM1 0.0 1061 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A9MM42 0.0 1060 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4TPG2 0.0 1058 80 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia pestis (strain Pestoides F)
Q1CL87 0.0 1058 80 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9QZS3 0.0 1058 80 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZC45 0.0 1058 80 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia pestis
Q1C4I9 0.0 1058 80 1 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Yersinia pestis bv. Antiqua (strain Antiqua)
B5Y0X1 0.0 1056 82 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Klebsiella pneumoniae (strain 342)
Q2NV94 0.0 1056 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Sodalis glossinidius (strain morsitans)
A6T5F3 0.0 1052 81 0 620 1 dxs 1-deoxy-D-xylulose-5-phosphate synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7MFG0 0.0 1041 80 0 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Cronobacter sakazakii (strain ATCC BAA-894)
B2VHS3 0.0 1029 77 0 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6LU07 0.0 1026 78 2 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Photobacterium profundum (strain SS9)
C4K6M7 0.0 989 76 1 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
C3LTD9 0.0 980 76 3 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Vibrio cholerae serotype O1 (strain M66-2)
Q9KTL3 0.0 980 76 3 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F331 0.0 980 76 3 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A7MYC6 0.0 977 76 2 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Vibrio campbellii (strain ATCC BAA-1116)
B7VJA1 0.0 977 75 3 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Vibrio atlanticus (strain LGP32)
Q87RU0 0.0 970 75 2 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B6EIA7 0.0 969 74 3 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Aliivibrio salmonicida (strain LFI1238)
Q5E6Z0 0.0 964 73 3 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q1LTI9 0.0 962 73 2 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
B5FBG6 0.0 962 73 3 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Aliivibrio fischeri (strain MJ11)
P57848 0.0 961 73 3 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pasteurella multocida (strain Pm70)
Q7MN49 0.0 959 75 2 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Vibrio vulnificus (strain YJ016)
Q8DFA3 0.0 959 74 2 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Vibrio vulnificus (strain CMCP6)
B0UUA4 0.0 950 72 3 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Histophilus somni (strain 2336)
Q0I3G1 0.0 949 72 3 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Histophilus somni (strain 129Pt)
P45205 0.0 941 72 3 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UC51 0.0 939 71 3 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Haemophilus influenzae (strain PittEE)
Q12L26 0.0 938 71 1 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A5UEV6 0.0 938 71 3 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Haemophilus influenzae (strain PittGG)
A4SJP9 0.0 938 73 2 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Aeromonas salmonicida (strain A449)
A0KNF9 0.0 938 73 2 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A1S8D4 0.0 937 73 1 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q4QKG6 0.0 937 71 3 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Haemophilus influenzae (strain 86-028NP)
Q07ZD4 0.0 934 70 1 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella frigidimarina (strain NCIMB 400)
B1KQY8 0.0 930 72 1 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella woodyi (strain ATCC 51908 / MS32)
Q65TP4 0.0 930 71 3 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A1RLV3 0.0 929 72 1 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella sp. (strain W3-18-1)
A4Y4X0 0.0 929 72 1 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A8FYL0 0.0 929 72 1 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella sediminis (strain HAW-EB3)
A3QGN9 0.0 928 72 1 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A8H6X1 0.0 927 71 1 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A9KTL5 0.0 926 71 1 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella baltica (strain OS195)
B8CS19 0.0 925 71 1 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
A3D2B2 0.0 924 71 1 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A6WL04 0.0 922 71 1 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella baltica (strain OS185)
B8EAU7 0.0 922 71 1 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella baltica (strain OS223)
B0TQ36 0.0 921 71 1 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella halifaxensis (strain HAW-EB4)
B8F3A4 0.0 914 71 3 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Glaesserella parasuis serovar 5 (strain SH0165)
Q8EGR9 0.0 911 71 1 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7VNP7 0.0 910 70 3 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A0KZA9 0.0 910 71 1 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella sp. (strain ANA-3)
B0BSL0 0.0 910 70 3 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H050 0.0 910 70 3 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MYS9 0.0 910 70 3 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q0HSW6 0.0 909 71 1 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella sp. (strain MR-7)
Q0HGL5 0.0 909 71 1 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shewanella sp. (strain MR-4)
Q493G7 0.0 894 68 2 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Blochmanniella pennsylvanica (strain BPEN)
A1SWW6 0.0 882 67 3 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B4RVY8 0.0 879 68 3 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q3II09 0.0 875 67 2 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudoalteromonas translucida (strain TAC 125)
Q5QVE8 0.0 869 66 1 613 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q487D3 0.0 868 66 3 629 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q15W93 0.0 861 67 2 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q8D357 0.0 858 66 1 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Wigglesworthia glossinidia brevipalpis
Q7VRH9 0.0 827 63 6 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Blochmanniella floridana
C1DAW8 0.0 795 62 2 609 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Laribacter hongkongensis (strain HLHK9)
Q7NUK5 0.0 795 63 3 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q1IFL1 0.0 791 61 4 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas entomophila (strain L48)
Q0A8V7 0.0 789 62 4 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B0KL79 0.0 786 61 2 613 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas putida (strain GB-1)
B1J3G4 0.0 785 61 2 613 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas putida (strain W619)
Q88QG7 0.0 785 60 2 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VXW9 0.0 785 60 2 610 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B8D7Z3 0.0 781 60 5 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D9P1 0.0 781 60 5 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A4XZ25 0.0 780 60 4 610 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas mendocina (strain ymp)
Q0AFY6 0.0 780 59 3 610 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q2SA08 0.0 780 62 4 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Hahella chejuensis (strain KCTC 2396)
P57536 0.0 779 60 5 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q60AN1 0.0 778 61 3 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A4VQS8 0.0 776 62 4 610 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Stutzerimonas stutzeri (strain A1501)
Q2YCH7 0.0 774 59 3 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A6V058 0.0 773 60 4 609 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas aeruginosa (strain PA7)
Q3JAD1 0.0 772 58 4 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q4K5A5 0.0 771 60 3 610 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q8K9A1 0.0 771 59 4 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q82VD3 0.0 770 60 3 610 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B8GN62 0.0 769 60 2 613 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q3K660 0.0 768 60 3 610 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas fluorescens (strain Pf0-1)
Q4ZYU8 0.0 767 60 2 609 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas syringae pv. syringae (strain B728a)
C3K2R1 0.0 764 60 3 610 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas fluorescens (strain SBW25)
Q889Q1 0.0 763 60 3 610 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48NX0 0.0 763 59 2 609 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q1GZD7 0.0 759 59 3 610 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q9KGU7 0.0 758 61 4 609 1 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02SL1 0.0 758 61 4 609 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V7R4 0.0 758 61 4 609 1 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pseudomonas aeruginosa (strain LESB58)
Q393P4 0.0 756 58 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q3SKF1 0.0 755 60 3 607 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thiobacillus denitrificans (strain ATCC 25259)
A0AYZ0 0.0 754 58 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia cenocepacia (strain HI2424)
Q1BLY7 0.0 754 58 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia orbicola (strain AU 1054)
B1K3S9 0.0 754 58 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia orbicola (strain MC0-3)
B4EN29 0.0 753 58 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B3PF22 0.0 752 57 4 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Cellvibrio japonicus (strain Ueda107)
Q21UG7 0.0 751 59 2 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q8P815 0.0 749 58 4 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UW29 0.0 749 58 4 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xanthomonas campestris pv. campestris (strain 8004)
Q0BAL8 0.0 749 57 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1Z1G2 0.0 749 57 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia ambifaria (strain MC40-6)
Q2KZ15 0.0 748 58 4 607 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bordetella avium (strain 197N)
Q8PJG7 0.0 746 58 4 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xanthomonas axonopodis pv. citri (strain 306)
A6VUE5 0.0 745 58 7 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Marinomonas sp. (strain MWYL1)
Q13RX1 0.0 745 58 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Paraburkholderia xenovorans (strain LB400)
A1TNR1 0.0 745 59 4 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Paracidovorax citrulli (strain AAC00-1)
B9MEU8 0.0 745 59 2 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Acidovorax ebreus (strain TPSY)
B2JP68 0.0 744 57 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A2SJ46 0.0 744 59 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q7W7Q0 0.0 744 58 3 604 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WL37 0.0 744 58 3 604 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q5H1A0 0.0 743 57 4 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQV8 0.0 743 57 4 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P472 0.0 743 57 4 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q7VV87 0.0 742 58 3 604 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
B1Y2X5 0.0 740 59 5 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q12CQ9 0.0 739 59 4 613 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q47BJ0 0.0 739 58 2 608 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Dechloromonas aromatica (strain RCB)
Q63JF4 0.0 738 58 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia pseudomallei (strain K96243)
Q3JKA3 0.0 738 58 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia pseudomallei (strain 1710b)
A3P7W4 0.0 738 58 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia pseudomallei (strain 1106a)
Q62DU1 0.0 738 58 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia mallei (strain ATCC 23344)
A1K4R0 0.0 738 57 2 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Azoarcus sp. (strain BH72)
A3NMF6 0.0 738 58 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia pseudomallei (strain 668)
B2FN57 0.0 738 59 5 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Stenotrophomonas maltophilia (strain K279a)
Q2T7N5 0.0 737 58 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q5P228 0.0 736 57 3 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A1VMD7 0.0 735 59 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Polaromonas naphthalenivorans (strain CJ2)
Q1LK34 0.0 734 57 6 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q87C03 0.0 733 56 5 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I607 0.0 733 56 5 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xylella fastidiosa (strain M23)
B3R5H4 0.0 733 58 6 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
B0U3E1 0.0 733 56 5 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xylella fastidiosa (strain M12)
Q474C2 0.0 732 57 6 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A9ITB0 0.0 729 59 4 607 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q0BLU9 0.0 728 57 4 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Francisella tularensis subsp. holarctica (strain OSU18)
A0Q6B9 0.0 728 57 4 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Francisella tularensis subsp. novicida (strain U112)
Q2A3D3 0.0 728 57 4 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Francisella tularensis subsp. holarctica (strain LVS)
A7NCA4 0.0 728 57 4 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q1R1E5 0.0 728 57 6 630 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q9PB95 0.0 728 56 5 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xylella fastidiosa (strain 9a5c)
Q3BRW8 0.0 727 57 4 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A4IXW5 0.0 726 57 4 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NG39 0.0 726 57 4 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14HJ1 0.0 726 57 4 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Francisella tularensis subsp. tularensis (strain FSC 198)
A1W4U9 0.0 725 58 2 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Acidovorax sp. (strain JS42)
Q0VMI4 0.0 724 57 4 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B2SGK5 0.0 721 56 4 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Francisella tularensis subsp. mediasiatica (strain FSC147)
B0U0B3 0.0 718 56 4 597 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q0K860 0.0 717 58 6 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B2U930 0.0 714 55 6 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Ralstonia pickettii (strain 12J)
A1KS32 0.0 711 56 7 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q8XX95 0.0 708 55 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q9JW13 0.0 705 56 6 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9JXV7 0.0 704 55 6 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M1G3 0.0 704 56 5 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Neisseria meningitidis serogroup C (strain 053442)
Q5FAI2 0.0 703 56 7 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q21F93 0.0 702 56 3 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B4RNW6 0.0 701 55 7 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Neisseria gonorrhoeae (strain NCCP11945)
A1WN06 0.0 697 57 3 609 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Verminephrobacter eiseniae (strain EF01-2)
B0VQB8 0.0 654 52 7 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Acinetobacter baumannii (strain SDF)
B0V710 0.0 653 52 7 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Acinetobacter baumannii (strain AYE)
Q11KE0 0.0 652 53 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chelativorans sp. (strain BNC1)
B0CKC0 0.0 640 52 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella suis (strain ATCC 23445 / NCTC 10510)
Q5NM38 0.0 638 51 6 623 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q6F7N5 0.0 638 51 7 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q985Y3 0.0 637 52 6 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A0L6H3 0.0 637 51 7 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q5NN52 0.0 637 51 6 621 3 dxs1 1-deoxy-D-xylulose-5-phosphate synthase 1 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q8YFM2 0.0 631 52 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RHE3 0.0 631 52 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella melitensis biotype 2 (strain ATCC 23457)
Q8G292 0.0 630 52 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella suis biovar 1 (strain 1330)
A9M8W0 0.0 630 52 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
A5VP09 0.0 630 52 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
B6IRB5 0.0 629 52 7 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodospirillum centenum (strain ATCC 51521 / SW)
Q57ET1 0.0 628 52 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella abortus biovar 1 (strain 9-941)
B2S9T6 0.0 628 52 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella abortus (strain S19)
Q74FC3 0.0 627 52 8 605 3 dxs1 1-deoxy-D-xylulose-5-phosphate synthase 1 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A6WWC4 0.0 627 52 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B3QFY7 0.0 626 52 7 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodopseudomonas palustris (strain TIE-1)
Q6NB76 0.0 626 52 7 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q2YMF0 0.0 626 51 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brucella abortus (strain 2308)
Q130G7 0.0 625 52 7 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodopseudomonas palustris (strain BisB5)
Q39RT4 0.0 624 49 6 622 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A5V6A9 0.0 621 52 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A8IBS1 0.0 621 51 6 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q07SR3 0.0 621 51 7 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodopseudomonas palustris (strain BisA53)
A4YQ36 0.0 621 51 10 638 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bradyrhizobium sp. (strain ORS 278)
Q6G4D1 0.0 621 51 7 628 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q3A3Z6 0.0 620 50 6 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q3SUZ1 0.0 619 52 9 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q21A74 0.0 617 52 7 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodopseudomonas palustris (strain BisB18)
Q89RW1 0.0 617 52 9 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q1QQ40 0.0 616 52 9 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A5EEQ0 0.0 615 51 9 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q92RJ1 0.0 615 51 8 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhizobium meliloti (strain 1021)
A1URW6 0.0 615 51 8 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
O67036 0.0 615 49 8 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Aquifex aeolicus (strain VF5)
Q2IRL7 0.0 614 51 7 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodopseudomonas palustris (strain HaA2)
A9IQP2 0.0 612 50 7 628 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bartonella tribocorum (strain CIP 105476 / IBS 506)
A7IPK6 0.0 609 52 8 605 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q2KBR2 0.0 608 50 8 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q6G0D4 0.0 608 51 7 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bartonella quintana (strain Toulouse)
B9JSL2 0.0 608 51 8 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B1I3J6 0.0 608 49 6 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Desulforudis audaxviator (strain MP104C)
B3PS68 0.0 605 50 8 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhizobium etli (strain CIAT 652)
Q1QE74 0.0 604 48 11 640 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q2GC13 0.0 602 50 6 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B5ZS68 0.0 602 49 8 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q0ARE5 0.0 601 49 7 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Maricaulis maris (strain MCS10)
Q1MKN4 0.0 600 50 8 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q8RAC5 0.0 599 48 4 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B2IDK3 0.0 598 51 6 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q5FUB1 0.0 598 51 10 635 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Gluconobacter oxydans (strain 621H)
Q4FN07 0.0 596 48 6 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pelagibacter ubique (strain HTCC1062)
Q1GQK9 0.0 595 49 7 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q8UHD7 0.0 595 50 8 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Agrobacterium fabrum (strain C58 / ATCC 33970)
B4RGW0 0.0 595 50 6 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Phenylobacterium zucineum (strain HLK1)
B9JAL7 0.0 594 49 8 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B2A526 0.0 593 48 5 609 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B0T3X7 0.0 592 50 6 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Caulobacter sp. (strain K31)
A7H9E8 0.0 592 50 9 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Anaeromyxobacter sp. (strain Fw109-5)
Q39UB1 0.0 592 48 6 619 3 dxs1 1-deoxy-D-xylulose-5-phosphate synthase 1 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q5LX42 0.0 592 49 8 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q0AZE2 0.0 590 48 5 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q74CB0 0.0 590 48 6 619 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q4FV64 0.0 589 48 11 638 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B9L1L6 0.0 587 49 10 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
Q16CP0 0.0 587 48 8 628 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B0TEJ5 0.0 587 47 6 613 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q2N6U5 0.0 587 49 7 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Erythrobacter litoralis (strain HTCC2594)
Q2LUA7 0.0 583 47 8 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Syntrophus aciditrophicus (strain SB)
Q2RYD6 0.0 582 48 8 623 3 dxs1 1-deoxy-D-xylulose-5-phosphate synthase 1 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q2RR29 0.0 580 48 8 623 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B8GXC4 0.0 580 50 6 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A6M5 0.0 580 50 6 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q1GCG4 0.0 579 48 9 629 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Ruegeria sp. (strain TM1040)
Q8KFI9 0.0 579 48 6 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q3J1A8 0.0 578 49 6 619 3 dxs1 1-deoxy-D-xylulose-5-phosphate synthase 1 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q3IYR6 0.0 577 48 7 617 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A5D2Z6 0.0 572 47 7 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q2IPZ2 0.0 570 49 9 613 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q3AAN0 0.0 568 47 4 607 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q2W367 0.0 567 50 7 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B8D2I3 0.0 566 47 6 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B4UHF5 0.0 566 49 9 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Anaeromyxobacter sp. (strain K)
Q30Z99 0.0 566 47 7 630 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B8JFY1 0.0 565 48 9 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q28WA7 0.0 565 47 8 623 3 dxs1 1-deoxy-D-xylulose-5-phosphate synthase 1 Jannaschia sp. (strain CCS1)
C0ZC10 0.0 564 46 5 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q28W25 0.0 563 47 10 628 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Jannaschia sp. (strain CCS1)
Q6AJQ1 0.0 563 47 8 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A8MFI7 0.0 561 47 5 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Alkaliphilus oremlandii (strain OhILAs)
Q0C154 0.0 557 50 6 591 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Hyphomonas neptunium (strain ATCC 15444)
C5D467 0.0 557 46 5 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Geobacillus sp. (strain WCH70)
Q3B5P3 0.0 555 47 6 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A1VE69 0.0 555 46 6 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nitratidesulfovibrio vulgaris (strain DP4)
Q72CD3 0.0 555 46 6 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q11NY7 0.0 555 45 7 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q10ZY2 0.0 554 47 5 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Trichodesmium erythraeum (strain IMS101)
B7KAF7 0.0 553 47 6 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Gloeothece citriformis (strain PCC 7424)
B8HWL8 0.0 552 47 7 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q2RIB9 0.0 551 47 6 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A4IQR7 0.0 550 45 5 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Geobacillus thermodenitrificans (strain NG80-2)
A0A803PDZ0 0.0 549 47 11 634 2 DXS2 1-deoxy-D-xylulose-5-phosphate synthase 2, chloroplastic Cannabis sativa
B1WWM7 0.0 548 46 7 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q75TB7 0.0 546 45 5 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Geobacillus kaustophilus (strain HTA426)
Q92BZ0 0.0 545 46 5 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B1HRX4 0.0 544 45 5 610 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Lysinibacillus sphaericus (strain C3-41)
B7JVJ6 0.0 543 46 6 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q2JTX2 0.0 542 46 8 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechococcus sp. (strain JA-3-3Ab)
Q7NP63 0.0 542 46 5 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q24V05 0.0 542 46 7 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Desulfitobacterium hafniense (strain Y51)
Q38854 0.0 542 47 9 623 1 DXS 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic Arabidopsis thaliana
P73067 0.0 541 46 6 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B8FQ45 0.0 541 46 7 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q2JK64 0.0 541 46 9 635 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechococcus sp. (strain JA-2-3B'a(2-13))
B0JL88 0.0 541 46 6 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
O22567 0.0 541 46 9 632 2 CLA1 1-deoxy-D-xylulose-5-phosphate synthase 1, chloroplastic Oryza sativa subsp. japonica
A0AIG6 0.0 541 45 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P26242 0.0 540 47 8 629 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodobacter capsulatus
Q9K971 0.0 538 44 7 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B2J5P1 0.0 538 45 7 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q3M4F6 0.0 538 45 7 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B0C8J3 0.0 537 46 6 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Acaryochloris marina (strain MBIC 11017)
A7Z6J5 0.0 537 45 5 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q8DL74 0.0 536 47 6 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q6HDY8 0.0 536 44 5 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q635A7 0.0 536 44 5 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus cereus (strain ZK / E33L)
B7JM28 0.0 536 44 5 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus cereus (strain AH820)
Q81M54 0.0 536 44 5 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus anthracis
C3LJV1 0.0 536 44 5 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P7V6 0.0 536 44 5 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus anthracis (strain A0248)
B1XKC5 0.0 536 46 6 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q8YZ80 0.0 535 45 7 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q97HD5 0.0 535 43 5 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B7HNU0 0.0 535 44 5 613 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus cereus (strain AH187)
A4SDG1 0.0 535 46 5 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A9VGD1 0.0 535 43 5 613 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus mycoides (strain KBAB4)
Q731B7 0.0 535 43 5 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q3ZXC2 0.0 534 44 8 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Dehalococcoides mccartyi (strain CBDB1)
A7GSJ5 0.0 534 43 5 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7IXG8 0.0 533 43 5 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus cereus (strain G9842)
B1YLQ5 0.0 533 44 5 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A0Q0A4 0.0 533 45 7 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium novyi (strain NT)
Q818R9 0.0 533 43 5 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HB48 0.0 533 43 5 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus cereus (strain B4264)
Q16DV7 0.0 533 45 9 640 3 dxs1 1-deoxy-D-xylulose-5-phosphate synthase 1 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A5FRB9 0.0 531 44 9 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
A8FF11 0.0 531 44 5 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus pumilus (strain SAFR-032)
B8E247 0.0 530 45 10 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q65HJ2 0.0 529 43 5 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q3Z8G9 1.41e-180 529 43 10 631 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
O78328 1.46e-180 531 46 9 632 2 TKT2 Probable 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic Capsicum annuum
Q8GAA0 2.73e-180 528 46 7 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q6YU51 3.9e-180 530 46 11 634 2 Os07g0190000 Probable 1-deoxy-D-xylulose-5-phosphate synthase 2, chloroplastic Oryza sativa subsp. japonica
B2RMK4 9.73e-180 526 43 6 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q9R6S7 1.05e-179 526 46 7 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q5WF63 1.13e-179 526 45 5 608 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Shouchella clausii (strain KSM-K16)
Q7MSZ3 1.3e-179 526 43 6 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
A5GTT4 4.59e-179 525 46 9 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechococcus sp. (strain RCC307)
A0A7J6EK66 5.63e-179 527 46 10 635 2 DXS1 1-deoxy-D-xylulose-5-phosphate synthase 1, chloroplastic Cannabis sativa
Q67NB6 7e-179 525 45 7 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P54523 2.41e-178 523 44 5 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacillus subtilis (strain 168)
B5YE06 3.37e-178 521 44 8 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
Q1IZP0 3.57e-178 522 46 5 610 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
A8G4R9 2.11e-177 520 45 7 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain MIT 9215)
Q1MRB3 4.01e-177 520 44 9 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Lawsonia intracellularis (strain PHE/MN1-00)
A2BR27 7.02e-176 516 44 7 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain AS9601)
A3PCV0 7.18e-176 516 45 7 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain MIT 9301)
Q31AZ2 7.91e-176 516 44 7 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain MIT 9312)
Q7V1G6 1e-175 516 44 7 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q46L36 2.39e-175 514 45 7 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain NATL2A)
Q9RUB5 4.39e-175 514 45 5 607 1 dxs 1-deoxy-D-xylulose-5-phosphate synthase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A6L175 7.55e-175 514 43 9 627 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
B3DW88 7.89e-175 513 41 6 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Methylacidiphilum infernorum (isolate V4)
C1F3C4 9.91e-175 513 42 5 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
A2C220 1.13e-174 513 45 7 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain NATL1A)
Q894H0 1.8e-174 512 42 5 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium tetani (strain Massachusetts / E88)
Q0IAA6 3.25e-174 513 44 10 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechococcus sp. (strain CC9311)
A5GL34 3.82e-174 512 44 10 629 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechococcus sp. (strain WH7803)
A6LFB9 6.53e-174 511 42 8 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A9BAC1 6.66e-174 511 45 7 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain MIT 9211)
Q72H81 7.29e-174 510 47 5 606 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q71ZV7 1.05e-173 510 44 7 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Listeria monocytogenes serotype 4b (strain F2365)
C1L2S1 1.05e-173 510 44 7 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q5SMD7 1.12e-173 510 47 5 606 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q64Y02 3.38e-173 510 41 7 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacteroides fragilis (strain YCH46)
Q5LH44 3.38e-173 510 41 7 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A9KMB8 5.6e-173 508 42 5 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q8Y7C1 3.62e-172 506 44 7 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q3AJP8 4.87e-172 507 45 9 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechococcus sp. (strain CC9605)
A2BWN6 6.48e-172 506 44 7 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain MIT 9515)
Q0TPD8 1.53e-171 504 43 4 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8XJE1 2.52e-171 504 43 4 615 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium perfringens (strain 13 / Type A)
B2V4R3 3.72e-171 504 44 5 609 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium botulinum (strain Alaska E43 / Type E3)
B9E6Q6 4.98e-171 504 42 4 613 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Macrococcus caseolyticus (strain JCSC5402)
B2TRM5 7.52e-171 503 44 7 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium botulinum (strain Eklund 17B / Type B)
Q0SS05 1.21e-170 502 43 6 616 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium perfringens (strain SM101 / Type A)
Q8F153 2.9e-170 502 41 3 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72U01 2.9e-170 502 41 3 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q18B68 3.21e-170 501 41 5 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridioides difficile (strain 630)
Q3AXZ4 4.92e-170 502 44 10 632 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Synechococcus sp. (strain CC9902)
B6YRV5 7.14e-170 501 41 6 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Azobacteroides pseudotrichonymphae genomovar. CFP2
Q8A0C2 2.19e-169 500 41 6 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q7VC14 3.49e-169 499 44 8 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A5N7J2 5.86e-169 498 43 8 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E104 5.86e-169 498 43 8 612 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium kluyveri (strain NBRC 12016)
Q7V7Q3 2.35e-168 498 44 7 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain MIT 9313)
A6LU48 2.38e-168 496 42 5 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A2C9X1 1e-167 496 45 7 617 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Prochlorococcus marinus (strain MIT 9303)
Q053M2 2.15e-167 494 42 5 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04U59 2.15e-167 494 42 5 618 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
A5ILK2 1.67e-166 491 42 8 620 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q7U6P6 1.28e-165 490 45 10 607 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Parasynechococcus marenigrum (strain WH8102)
Q9X291 2.24e-163 483 42 6 610 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B1LAQ3 2.95e-162 481 42 6 610 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thermotoga sp. (strain RQ2)
A0RMN5 1.08e-159 474 41 6 602 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Campylobacter fetus subsp. fetus (strain 82-40)
A8L0K9 9.03e-159 473 40 7 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Parafrankia sp. (strain EAN1pec)
B2S462 2.67e-155 463 40 9 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Treponema pallidum subsp. pallidum (strain SS14)
O83796 2.67e-155 463 40 9 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Treponema pallidum (strain Nichols)
A8FKB0 1.14e-153 459 39 5 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q30TC5 4.96e-153 457 40 8 599 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q6MDK6 5.64e-153 457 40 6 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Protochlamydia amoebophila (strain UWE25)
Q9PIH8 7.58e-153 457 39 5 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A1VY40 7.74e-153 457 39 5 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q2JDD9 8.52e-153 458 40 7 611 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q5HWF0 9.61e-153 456 39 5 614 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Campylobacter jejuni (strain RM1221)
Q7VIJ7 1.44e-152 456 39 7 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q9ZM94 3.5e-152 455 40 7 599 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Helicobacter pylori (strain J99 / ATCC 700824)
A7H552 8.81e-152 454 39 4 605 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
O25121 4.25e-151 452 40 7 599 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Helicobacter pylori (strain ATCC 700392 / 26695)
B5ZAB7 4.44e-151 452 40 7 599 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Helicobacter pylori (strain G27)
A8EWN0 4.83e-151 451 39 8 604 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Aliarcobacter butzleri (strain RM4018)
Q1CUF6 8.04e-151 452 40 7 599 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Helicobacter pylori (strain HPAG1)
A7I2V7 1.11e-150 451 40 7 594 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q7M7Z0 1.71e-150 451 40 10 603 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q73LF4 2.32e-148 446 38 8 631 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q47NL9 3.85e-148 445 38 10 619 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Thermobifida fusca (strain YX)
Q9F1V2 6.12e-146 440 39 9 623 3 dxs1 1-deoxy-D-xylulose-5-phosphate synthase 1 Kitasatospora griseola
Q9Z6J9 1.11e-145 439 38 9 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlamydia pneumoniae
B1VWJ8 2.44e-145 438 38 11 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
B1MCU7 2.64e-145 438 39 10 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
A6Q1Z6 6.42e-145 436 39 7 598 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Nitratiruptor sp. (strain SB155-2)
Q7UWB7 5.53e-144 434 37 8 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q8CJP7 3.4e-143 433 38 11 626 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q4JVB5 2.51e-142 430 39 10 622 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Corynebacterium jeikeium (strain K411)
Q8NPB2 4.44e-142 430 37 10 630 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q82KW8 5.67e-142 430 38 10 621 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A4QEQ9 8.27e-142 429 37 10 626 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Corynebacterium glutamicum (strain R)
A0QW19 1.11e-140 426 38 10 633 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8VUR8 1.96e-140 426 38 12 626 3 dxs2 1-deoxy-D-xylulose-5-phosphate synthase 2 Kitasatospora griseola
Q0S1H1 3.93e-140 425 39 9 623 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodococcus jostii (strain RHA1)
Q9RBN6 8.93e-139 421 38 9 617 1 dxs 1-deoxy-D-xylulose-5-phosphate synthase Streptomyces sp. (strain CL190)
Q5L6H4 1.76e-138 421 38 9 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlamydia abortus (strain DSM 27085 / S26/3)
B0BBW4 5e-138 419 38 10 631 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B7P9 5e-138 419 38 10 631 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
A4TCS5 6.32e-138 419 38 9 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycolicibacterium gilvum (strain PYR-GCK)
Q1B9W8 6.37e-138 419 38 9 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium sp. (strain MCS)
A1UF44 6.37e-138 419 38 9 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium sp. (strain KMS)
P9WNS3 8.8e-138 419 38 9 633 1 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNS2 8.8e-138 419 38 9 633 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U634 8.8e-138 419 38 9 633 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AFE1 8.8e-138 419 38 9 633 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KM20 8.8e-138 419 38 9 633 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A555 8.8e-138 419 38 9 633 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q3KM28 1.47e-137 418 38 10 631 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
O84335 1.57e-137 418 38 10 631 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
A3PYK6 2.87e-137 417 37 9 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium sp. (strain JLS)
C0ZYV9 3.95e-137 417 37 9 624 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q9PK62 3.74e-136 414 37 8 625 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Chlamydia muridarum (strain MoPn / Nigg)
Q8FPI2 3.99e-136 414 37 10 621 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8R639 4.05e-136 413 37 6 583 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q50000 5.47e-136 414 38 8 631 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium leprae (strain TN)
B8ZQW9 5.47e-136 414 38 8 631 3 dxs 1-deoxy-D-xylulose-5-phosphate synthase Mycobacterium leprae (strain Br4923)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00450
Feature type CDS
Gene dxs
Product 1-deoxy-D-xylulose-5-phosphate synthase
Location 120570 - 122444 (strand: -1)
Length 1875 (nucleotides) / 624 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2288
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02779 Transketolase, pyrimidine binding domain
PF02780 Transketolase, C-terminal domain
PF13292 1-deoxy-D-xylulose-5-phosphate synthase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1154 Coenzyme transport and metabolism (H)
Lipid transport and metabolism (I)
HI Deoxyxylulose-5-phosphate synthase

Kegg Ortholog Annotation(s)

Protein Sequence

MSIDIEKYPTLALVETPEDLRLLPKESLPKLCDELRLYLLNSVSRSSGHFASGLGAIELTVALHYVYKTPFDNLIWDVGHQAYPHKILTGRRDRIDTIRQKNGLHPFPWRDESEYDKLCVGHSSTSISAGLGMAVAAEQENLGRKTVCVIGDGAITAGMAFEAMNHAGDINPDMLVVLNDNEMSISENVGALNNHLAQLLSGKLYTTLREGGKKVFSGIPPIKELLKKTEEHIKGMVVPGTMFEELGFNYIGPVDGHDVIALVQTLTNMRDLKGPQLLHIMTKKGRGYAPAEQDPISWHAVPKFDPKTGTLPKSPNARPTFSKIFGDWLCEEAATDEKLMAITPAMREGSGMVRFSKEYPAQYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVIHDVAIQKLPVLFAIDRGGIVGADGQTHQGAFDLSFLRCIPNMIIMAPSDENECRQMLHTGYHYQEGPVAVRYPRGSGVGAPLQPLSELPIGKGIIRRQGKSIAILNFGTLLPEALDVAEKLDATVADMRFIKPLDKELILSLAKQHDILVTLEENAIMGGAGSGVNELLMQERCLVPVLNLGLPDLFVPQGGQEEIRADLGLDATGIEKSIKAYQAHSLR

Flanking regions ( +/- flanking 50bp)

CAGCTTACCTGCTCTTTCCCTATTACAAGTCATTAATTAATAGGCATCACATGAGCATTGATATCGAAAAATATCCCACATTGGCGTTGGTTGAAACACCCGAAGATTTACGCCTATTACCAAAAGAGAGTTTACCTAAACTCTGTGATGAGCTAAGGCTATATCTTCTTAACAGTGTCAGCCGCTCAAGTGGTCACTTCGCCTCAGGTTTAGGTGCTATTGAGTTAACGGTTGCGCTTCATTACGTTTATAAAACTCCCTTTGACAATCTGATTTGGGATGTGGGCCATCAGGCTTATCCTCATAAAATATTAACGGGTCGTCGTGATCGCATTGATACTATTCGTCAAAAAAACGGCTTACATCCCTTCCCTTGGCGTGATGAGAGTGAATATGACAAACTCTGTGTTGGTCATTCATCCACCTCTATCAGTGCTGGACTGGGTATGGCTGTTGCTGCAGAGCAAGAAAACCTAGGCAGAAAGACTGTTTGTGTGATTGGTGACGGTGCAATTACTGCAGGAATGGCATTTGAAGCCATGAATCATGCCGGTGATATTAATCCAGATATGCTAGTGGTACTTAACGATAATGAAATGTCGATTTCAGAAAATGTCGGGGCACTAAATAACCACCTTGCACAACTTCTATCTGGCAAACTGTATACCACGCTACGTGAAGGTGGCAAAAAAGTCTTTTCTGGTATTCCCCCAATTAAAGAATTACTGAAAAAGACAGAAGAACATATTAAAGGCATGGTTGTGCCCGGCACCATGTTTGAAGAGTTAGGTTTTAACTATATTGGTCCAGTTGATGGTCACGATGTTATTGCTTTAGTACAAACGCTCACGAATATGCGCGATCTAAAAGGGCCGCAACTTTTACATATTATGACCAAAAAAGGTCGGGGTTACGCTCCCGCAGAGCAAGATCCAATCAGTTGGCATGCGGTACCTAAATTTGATCCAAAGACAGGTACTTTACCTAAAAGCCCGAATGCACGCCCGACGTTTTCAAAAATTTTTGGGGACTGGTTATGTGAAGAAGCTGCCACTGATGAAAAGTTAATGGCAATCACCCCTGCTATGCGTGAAGGCTCTGGTATGGTGCGCTTTTCTAAAGAGTACCCCGCACAATACTTTGATGTCGCAATTGCGGAGCAACACGCCGTCACCTTCGCTGCTGGATTAGCTATTGGTGGTTATAAGCCGATCGTGGCTATTTACTCTACCTTCTTACAACGCGCTTATGATCAAGTGATCCACGATGTGGCTATCCAAAAACTCCCGGTACTCTTTGCTATCGATCGTGGTGGCATTGTTGGTGCGGATGGTCAGACCCACCAAGGAGCTTTTGATCTCTCTTTCTTACGCTGTATCCCTAATATGATTATTATGGCACCTAGCGATGAAAATGAGTGTCGCCAAATGTTGCACACAGGTTACCATTATCAAGAAGGGCCTGTCGCTGTACGTTATCCTAGAGGATCAGGGGTTGGTGCGCCATTACAACCGCTGAGCGAACTTCCTATAGGAAAAGGTATTATTCGTCGCCAAGGTAAAAGTATTGCAATTTTAAACTTCGGAACCTTATTACCCGAAGCCTTAGATGTTGCAGAAAAACTGGATGCAACAGTTGCAGATATGCGCTTTATCAAACCACTAGATAAAGAACTGATCCTTTCCCTTGCCAAACAACACGACATACTGGTCACCTTAGAAGAAAATGCCATTATGGGTGGCGCAGGTAGCGGCGTTAACGAGTTATTAATGCAAGAGCGTTGTTTAGTGCCCGTACTCAATTTAGGGTTACCTGATCTTTTTGTGCCACAAGGTGGACAAGAAGAGATCAGAGCCGATTTAGGACTTGATGCAACAGGCATTGAAAAATCGATTAAAGCTTATCAGGCTCATTCTTTGAGATAATATTTCAAAAGTCTCTCTTGCTTGTAAAGCCGGAGAGACTATTGATAAGG