Homologs in group_2885

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_17500 EHELCC_17500 100.0 Morganella morganii S2 uspF universal stress protein UspF
NLDBIP_18710 NLDBIP_18710 100.0 Morganella morganii S4 uspF universal stress protein UspF
LHKJJB_17940 LHKJJB_17940 100.0 Morganella morganii S3 uspF universal stress protein UspF
HKOGLL_18710 HKOGLL_18710 100.0 Morganella morganii S5 uspF universal stress protein UspF
F4V73_RS08100 F4V73_RS08100 95.8 Morganella psychrotolerans uspF universal stress protein UspF

Distribution of the homologs in the orthogroup group_2885

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2885

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P67091 1.03e-53 169 54 0 144 1 uspF Universal stress protein F Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67092 1.03e-53 169 54 0 144 3 uspF Universal stress protein F Salmonella typhi
P0A4P8 5.69e-50 159 52 0 144 3 uspF Universal stress protein F Shigella flexneri
P0A4P6 5.69e-50 159 52 0 144 3 uspF Universal stress protein F Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TI19 5.69e-50 159 52 0 144 3 uspF Universal stress protein F Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P0A4P7 5.69e-50 159 52 0 144 3 uspF Universal stress protein F Escherichia coli O157:H7
P37903 5.75e-50 159 52 0 144 1 uspF Universal stress protein F Escherichia coli (strain K12)
Q8FK07 4.16e-26 99 41 4 146 3 uspG Universal stress protein G Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P39177 7.72e-26 98 40 4 146 1 uspG Universal stress protein UP12 Escherichia coli (strain K12)
Q8XBT3 1.02e-25 97 40 4 146 3 uspG Universal stress protein G Escherichia coli O157:H7
Q83M07 6.53e-25 95 39 4 146 3 uspG Universal stress protein G Shigella flexneri
P67093 5.35e-23 90 38 4 146 3 uspG Universal stress protein G Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67094 5.35e-23 90 38 4 146 3 uspG Universal stress protein G Salmonella typhi
P45680 2.74e-08 52 28 4 145 1 uspA2 Universal stress protein A homolog 2 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
E1VBK4 5.49e-08 52 26 4 152 1 teaD TRAP-T-associated universal stress protein TeaD Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)
Q83AC1 2.87e-07 50 29 4 144 3 uspA1 Universal stress protein A homolog 1 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
P74148 1.57e-06 48 26 5 153 3 sll1388 Universal stress protein Sll1388 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q57951 6.88e-06 46 28 6 149 3 MJ0531 Universal stress protein MJ0531 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q50777 2.37e-05 44 30 1 85 3 MTBMA_c15380 Universal stress protein MTBMA_c15380 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q2FXL6 8.48e-05 43 30 8 153 3 SAOUHSC_01819 Putative universal stress protein SAOUHSC_01819 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q6GFZ7 8.48e-05 43 30 8 153 3 SAR1788 Putative universal stress protein SAR1788 Staphylococcus aureus (strain MRSA252)
Q5HF64 8.48e-05 43 30 8 153 3 SACOL1759 Putative universal stress protein SACOL1759 Staphylococcus aureus (strain COL)
Q99TF3 8.48e-05 43 30 8 153 3 SAV1710 Putative universal stress protein SAV1710 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2FG28 8.48e-05 43 30 8 153 3 SAUSA300_1656 Putative universal stress protein SAUSA300_1656 Staphylococcus aureus (strain USA300)
Q7A0N0 8.48e-05 43 30 8 153 3 MW1653 Putative universal stress protein MW1653 Staphylococcus aureus (strain MW2)
Q6G8L7 8.48e-05 43 30 8 153 3 SAS1637 Putative universal stress protein SAS1637 Staphylococcus aureus (strain MSSA476)
Q2YTD0 8.48e-05 43 30 8 153 3 SAB1569 Putative universal stress protein SAB1569 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A551 8.48e-05 43 30 8 153 1 SA1532 Putative universal stress protein SA1532 Staphylococcus aureus (strain N315)
Q49YE0 0.000173 42 30 8 153 3 SSP1056 Putative universal stress protein SSP1056 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_11580
Feature type CDS
Gene uspF
Product universal stress protein UspF
Location 112244 - 112678 (strand: -1)
Length 435 (nucleotides) / 144 (amino acids)

Contig

Accession contig_13
Length 135581 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2885
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00582 Universal stress protein family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0589 Signal transduction mechanisms (T) T Nucleotide-binding universal stress protein, UspA family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K14061 universal stress protein F - -

Protein Sequence

MYKTIIVPIDISETGLTREVIPTIQTLAKFENAKIHFIAVIPSFSHFASFGIAYAATLPEKDEILDSAKEQLAKMVSDFNLPAEQFELHVVSGSPKDQILKLADTLESDLIVISSRRPDMSTYLLGSNAAAVVRYAHTSVLVVR

Flanking regions ( +/- flanking 50bp)

GTTACTATTACTACTAACTTATTTGCCGGCTTTCAGATTGCGAGGTATGTATGTATAAAACGATTATAGTTCCAATCGATATTTCCGAAACCGGGCTGACCCGCGAGGTGATCCCGACGATTCAGACATTAGCCAAATTTGAAAATGCCAAAATTCACTTTATAGCGGTGATCCCGTCATTCTCTCACTTTGCCTCTTTCGGTATTGCCTATGCCGCAACTCTGCCGGAAAAAGATGAAATTCTGGACAGCGCCAAAGAACAACTGGCGAAGATGGTCAGTGATTTTAATCTGCCTGCAGAGCAGTTTGAACTGCATGTGGTTTCCGGCTCACCGAAAGATCAGATTCTGAAACTGGCGGATACTCTGGAAAGCGACCTGATTGTCATCAGCTCACGCCGCCCGGATATGTCCACCTATCTGCTCGGCTCCAACGCCGCAGCGGTTGTACGCTACGCCCATACCTCGGTTCTGGTTGTCCGCTGATACGCGGCAGCGCCTGACTGAACGCCCGTTTTAACGGGCGTTTGTTTTTT