Homologs in group_87

Help

11 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06695 FBDBKF_06695 69.5 Morganella morganii S1 - tRNA-dihydrouridine synthase C
EHELCC_04275 EHELCC_04275 69.5 Morganella morganii S2 - tRNA-dihydrouridine synthase C
EHELCC_04320 EHELCC_04320 100.0 Morganella morganii S2 dusC tRNA dihydrouridine(16) synthase DusC
NLDBIP_04275 NLDBIP_04275 69.5 Morganella morganii S4 - tRNA-dihydrouridine synthase C
NLDBIP_04320 NLDBIP_04320 100.0 Morganella morganii S4 dusC tRNA dihydrouridine(16) synthase DusC
LHKJJB_10105 LHKJJB_10105 69.5 Morganella morganii S3 - tRNA-dihydrouridine synthase C
LHKJJB_14310 LHKJJB_14310 100.0 Morganella morganii S3 dusC tRNA dihydrouridine(16) synthase DusC
HKOGLL_08870 HKOGLL_08870 69.5 Morganella morganii S5 - tRNA-dihydrouridine synthase C
HKOGLL_12225 HKOGLL_12225 100.0 Morganella morganii S5 dusC tRNA dihydrouridine(16) synthase DusC
F4V73_RS00835 F4V73_RS00835 71.9 Morganella psychrotolerans dusC tRNA dihydrouridine(16) synthase DusC
PMI_RS03060 PMI_RS03060 70.6 Proteus mirabilis HI4320 dusC tRNA dihydrouridine(16) synthase DusC

Distribution of the homologs in the orthogroup group_87

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_87

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZGV2 0.0 548 83 0 310 3 dusC tRNA-dihydrouridine(16) synthase Yersinia pestis
Q8FFV5 0.0 521 79 0 310 3 dusC tRNA-dihydrouridine(16) synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P33371 0.0 520 78 0 310 1 dusC tRNA-dihydrouridine(16) synthase Escherichia coli (strain K12)
Q7UC91 0.0 518 78 0 310 3 dusC tRNA-dihydrouridine(16) synthase Shigella flexneri
Q8XEC6 0.0 517 78 0 310 3 dusC tRNA-dihydrouridine(16) synthase Escherichia coli O157:H7
Q8Z5B2 0.0 513 78 0 310 3 dusC tRNA-dihydrouridine(16) synthase Salmonella typhi
Q8ZNM4 0.0 510 78 0 310 3 dusC tRNA-dihydrouridine(16) synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9CJW1 1.64e-158 447 69 0 295 3 dusC tRNA-dihydrouridine(16) synthase Pasteurella multocida (strain Pm70)
P44606 8.19e-156 441 67 0 303 3 dusC tRNA-dihydrouridine(16) synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7VKU5 3.15e-148 422 65 0 294 3 dusC tRNA-dihydrouridine(16) synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q87N01 2.8e-133 384 57 0 308 3 dusC tRNA-dihydrouridine(16) synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8DAH1 1.79e-131 379 57 0 309 3 dusC tRNA-dihydrouridine(16) synthase Vibrio vulnificus (strain CMCP6)
Q9KT00 2.93e-130 376 57 0 303 3 dusC tRNA-dihydrouridine(16) synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8EFG7 4.14e-118 345 53 1 308 3 dusC tRNA-dihydrouridine(16) synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9AMN9 1.62e-87 267 41 3 312 3 dusC tRNA-dihydrouridine(16) synthase Pseudomonas alcaligenes
Q9HZ95 4.89e-86 264 41 3 313 3 dusC tRNA-dihydrouridine(16) synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q88LF2 2.43e-84 259 41 3 313 3 dusC tRNA-dihydrouridine(16) synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8XYX1 3.31e-84 259 41 5 312 3 dusC tRNA-dihydrouridine(16) synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
O68273 2.04e-79 247 38 3 313 3 dusC tRNA-dihydrouridine(16) synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q884C6 1.64e-78 244 41 2 301 3 dusC tRNA-dihydrouridine(16) synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9JUP6 1.52e-75 237 37 4 316 3 dusC tRNA-dihydrouridine(16) synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9JZL5 3.62e-75 236 37 4 313 3 dusC tRNA-dihydrouridine(16) synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q55724 3.4e-43 154 33 9 312 3 dus1 Probable tRNA-dihydrouridine synthase 1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P41504 2.2e-35 133 31 8 303 3 dus Probable tRNA-dihydrouridine synthase Rhizobium leguminosarum bv. phaseoli
Q7VNP2 2.84e-35 132 33 7 239 3 dusB tRNA-dihydrouridine synthase B Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9HUW1 1.89e-34 130 34 6 240 3 dusB tRNA-dihydrouridine synthase B Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9CLW3 5.88e-34 129 34 7 239 3 dusB tRNA-dihydrouridine synthase B Pasteurella multocida (strain Pm70)
P96192 7.8e-34 129 36 6 249 3 dusC tRNA-dihydrouridine(16) synthase Azotobacter vinelandii
Q92JQ6 2.84e-33 127 35 7 232 3 dus Probable tRNA-dihydrouridine synthase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P44965 6.14e-33 127 35 7 239 3 dusB tRNA-dihydrouridine synthase B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4UNJ4 9.06e-33 126 31 6 239 3 dus Probable tRNA-dihydrouridine synthase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9ZED2 1.46e-32 125 31 5 238 3 dus Probable tRNA-dihydrouridine synthase Rickettsia prowazekii (strain Madrid E)
Q68XZ3 2.59e-31 122 31 5 238 3 dus Probable tRNA-dihydrouridine synthase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P37567 2.68e-31 122 30 16 330 3 dus1 Probable tRNA-dihydrouridine synthase 1 Bacillus subtilis (strain 168)
Q87KU1 4.81e-31 121 32 11 298 3 dusB tRNA-dihydrouridine synthase B Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
O52533 5.33e-31 121 34 7 241 3 dusB tRNA-dihydrouridine synthase B Proteus vulgaris
Q1RH84 6.4e-31 121 33 7 231 3 dus Probable tRNA-dihydrouridine synthase Rickettsia bellii (strain RML369-C)
Q8PP72 3.68e-30 119 33 6 231 3 dusB tRNA-dihydrouridine synthase B Xanthomonas axonopodis pv. citri (strain 306)
Q8PCH1 7.65e-30 119 32 4 231 3 dusB tRNA-dihydrouridine synthase B Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
O52536 2.32e-29 117 32 7 241 3 dusB tRNA-dihydrouridine synthase B Klebsiella pneumoniae
Q8ZAX7 4.82e-29 116 35 4 199 3 dusB tRNA-dihydrouridine synthase B Yersinia pestis
O25427 9.56e-29 115 33 5 219 3 dus Probable tRNA-dihydrouridine synthase Helicobacter pylori (strain ATCC 700392 / 26695)
Q83PZ5 1.11e-28 115 32 7 241 3 dusB tRNA-dihydrouridine synthase B Shigella flexneri
P0ABT5 1.77e-28 114 32 7 241 1 dusB tRNA-dihydrouridine synthase B Escherichia coli (strain K12)
P0ABT6 1.77e-28 114 32 7 241 3 dusB tRNA-dihydrouridine synthase B Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABT7 1.77e-28 114 32 7 241 3 dusB tRNA-dihydrouridine synthase B Escherichia coli O157:H7
P0A2R6 5.77e-28 113 31 7 241 3 dusB tRNA-dihydrouridine synthase B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2R7 5.77e-28 113 31 7 241 3 dusB tRNA-dihydrouridine synthase B Salmonella typhi
Q8CWL2 1.07e-27 112 31 10 298 3 dusB tRNA-dihydrouridine synthase B Vibrio vulnificus (strain CMCP6)
P45672 1.52e-27 112 32 7 231 3 dus Probable tRNA-dihydrouridine synthase Azospirillum brasilense
Q8EJR8 2.58e-27 111 31 7 246 3 dusB tRNA-dihydrouridine synthase B Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q88DK5 4.63e-27 111 37 3 156 3 dusB tRNA-dihydrouridine synthase B Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9ZLB6 1.34e-26 110 31 5 219 3 dus Probable tRNA-dihydrouridine synthase Helicobacter pylori (strain J99 / ATCC 700824)
Q87VS1 1.3e-25 107 32 8 244 3 dusB tRNA-dihydrouridine synthase B Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
O52539 1.43e-25 107 31 8 244 3 dusB tRNA-dihydrouridine synthase B Pectobacterium carotovorum
Q9KV66 2.52e-25 106 35 7 231 3 dusB tRNA-dihydrouridine synthase B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q08111 9.11e-25 104 34 6 230 3 dus Probable tRNA-dihydrouridine synthase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q09504 2.81e-24 102 36 4 168 3 C45G9.2 Uncharacterized tRNA-dihydrouridine synthase-like protein C45G9.2 Caenorhabditis elegans
O67533 2e-23 101 27 10 319 3 dus Probable tRNA-dihydrouridine synthase Aquifex aeolicus (strain VF5)
O95620 4.52e-23 100 32 5 178 1 DUS4L tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like Homo sapiens
Q32M08 2.57e-22 98 30 5 179 2 Dus4l tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like Mus musculus
O52532 9.86e-22 96 35 3 174 3 dusB tRNA-dihydrouridine synthase B Serratia marcescens
O83945 1.7e-20 93 31 7 248 3 dus Probable tRNA-dihydrouridine synthase Treponema pallidum (strain Nichols)
P53759 4.22e-20 93 32 6 211 1 DUS1 tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8C2P3 2.04e-19 91 28 12 314 2 Dus1l tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like Mus musculus
O74553 2.51e-19 90 35 4 160 1 dus4 tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8K582 2.66e-19 90 28 12 314 2 Dus1l tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like Rattus norvegicus
O31546 3.55e-19 89 31 6 239 3 dus2 Probable tRNA-dihydrouridine synthase 2 Bacillus subtilis (strain 168)
Q6P1R4 6.5e-19 90 28 12 314 1 DUS1L tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like Homo sapiens
Q8NYV4 1.66e-18 87 31 9 238 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain MW2)
Q6GD38 1.66e-18 87 31 9 238 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain MSSA476)
Q5HJT5 1.66e-18 87 31 9 238 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain COL)
P67717 1.71e-18 87 31 9 238 1 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain N315)
P67716 1.71e-18 87 31 9 238 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6GKK9 1.73e-18 87 31 9 238 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain MRSA252)
P9WNS7 1.36e-17 85 28 7 235 1 dus Probable tRNA-dihydrouridine synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNS6 1.36e-17 85 28 7 235 3 dus Probable tRNA-dihydrouridine synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q5HKD5 1.91e-17 84 29 8 235 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q50049 8.87e-17 83 34 4 143 3 dus Probable tRNA-dihydrouridine synthase Mycobacterium leprae (strain TN)
Q8CU07 9.12e-17 82 29 8 235 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q88KX0 1.25e-16 82 29 6 222 3 dusA tRNA-dihydrouridine(20/20a) synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9NX74 1.26e-16 83 30 6 215 1 DUS2 tRNA-dihydrouridine(20) synthase [NAD(P)+]-like Homo sapiens
Q9D7B1 6.95e-16 81 27 7 265 1 Dus2 tRNA-dihydrouridine(20) synthase [NAD(P)+]-like Mus musculus
Q9I048 7.42e-16 80 27 8 287 3 dusA tRNA-dihydrouridine(20/20a) synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P72872 4.76e-15 77 28 7 245 3 dus2 tRNA-dihydrouridine(20/20a) synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8ZJ14 9.22e-15 77 29 7 225 3 dusA tRNA-dihydrouridine(20/20a) synthase Yersinia pestis
Q7ZWS1 1.55e-14 77 32 8 186 2 dus3l tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Xenopus laevis
Q8CWK7 1.7e-14 76 28 7 238 3 dusA tRNA-dihydrouridine(20/20a) synthase Vibrio vulnificus (strain CMCP6)
Q9KUX9 2.67e-14 75 29 8 228 3 dusA tRNA-dihydrouridine(20/20a) synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8P3X4 6.65e-14 74 31 7 221 3 dusA tRNA-dihydrouridine(20/20a) synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q54CU9 7.89e-14 75 28 3 147 3 dus3l tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Dictyostelium discoideum
A8NZY7 1.22e-13 74 29 11 244 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003)
Q87L85 1.4e-13 73 27 6 223 3 dusA tRNA-dihydrouridine(20/20a) synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q28BT8 1.63e-13 74 31 8 186 2 dus3l tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Xenopus tropicalis
A8PTG4 1.87e-13 74 26 7 248 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Malassezia globosa (strain ATCC MYA-4612 / CBS 7966)
P0CN28 2.27e-13 73 28 11 250 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
P0CN29 2.35e-13 73 28 11 250 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
O74731 4.22e-13 72 24 10 285 1 dus2 tRNA-dihydrouridine(20) synthase [NAD(P)+] Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q884G7 8.5e-13 71 27 7 229 3 dusA tRNA-dihydrouridine(20/20a) synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q5ALL3 9.4e-13 72 28 4 159 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Candida albicans (strain SC5314 / ATCC MYA-2876)
Q96G46 1.01e-12 72 29 7 177 1 DUS3L tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Homo sapiens
Q9UTH9 1.24e-12 71 29 6 179 1 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8EAJ0 1.47e-12 70 28 6 222 3 dusA tRNA-dihydrouridine(20/20a) synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9HGN6 1.77e-12 70 27 9 235 1 dus1 tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q7XT07 1.78e-12 71 28 8 182 2 Os04g0117600 tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Oryza sativa subsp. japonica
Q9T0J6 2.15e-12 71 30 10 186 1 At4g38890 tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Arabidopsis thaliana
A5DTS1 2.69e-12 70 29 5 160 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239)
Q9CL29 2.7e-12 69 27 9 250 3 dusA tRNA-dihydrouridine(20/20a) synthase Pasteurella multocida (strain Pm70)
Q1E2F4 2.9e-12 70 29 7 181 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Coccidioides immitis (strain RS)
A3LUK5 5.67e-12 69 27 5 179 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
Q06063 6.48e-12 68 30 3 146 1 DUS4 tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8FB30 7.31e-12 68 26 9 253 3 dusA tRNA-dihydrouridine(20/20a) synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q4P1U2 8.69e-12 69 28 6 204 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Ustilago maydis (strain 521 / FGSC 9021)
P32695 1.51e-11 67 26 9 253 1 dusA tRNA-dihydrouridine(20/20a) synthase Escherichia coli (strain K12)
Q8X5V6 1.51e-11 67 26 9 253 3 dusA tRNA-dihydrouridine(20/20a) synthase Escherichia coli O157:H7
Q7UBC5 1.55e-11 67 26 9 253 3 dusA tRNA-dihydrouridine(20/20a) synthase Shigella flexneri
A5DBS1 2.31e-11 67 26 5 179 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324)
P44794 2.44e-11 67 26 7 243 3 dusA tRNA-dihydrouridine(20/20a) synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q6BS64 2.88e-11 67 27 5 159 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
A4RLF4 3.85e-11 67 29 6 178 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q8ZKH4 4.23e-11 66 26 9 253 3 dusA tRNA-dihydrouridine(20/20a) synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q6FJ14 6.17e-11 66 27 6 188 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q3KRC5 8.42e-11 66 29 7 177 2 Dus3l tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Rattus norvegicus
Q8Z1T1 8.6e-11 65 25 8 253 3 dusA tRNA-dihydrouridine(20/20a) synthase Salmonella typhi
A2QAU6 9.04e-11 66 28 7 180 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
Q8PFF8 1.27e-10 65 25 7 264 3 dusA tRNA-dihydrouridine(20/20a) synthase Xanthomonas axonopodis pv. citri (strain 306)
Q7VNV2 2.8e-10 63 24 9 234 3 dusA tRNA-dihydrouridine(20/20a) synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q5SMC7 2.99e-10 63 31 6 177 1 dus tRNA-dihydrouridine(20/20a) synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
A6QYC6 4.67e-10 63 27 7 179 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Ajellomyces capsulatus (strain NAm1 / WU24)
Q91XI1 5.43e-10 63 28 7 177 1 Dus3l tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Mus musculus
Q2UL89 6.68e-10 63 27 7 179 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Aspergillus oryzae (strain ATCC 42149 / RIB 40)
A1CNY3 9.51e-10 63 27 7 179 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
Q7SG01 1.2e-09 62 28 7 178 3 dus-3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q5BF62 1.98e-09 62 27 6 179 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A6RMI1 2.85e-09 61 27 6 180 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Botryotinia fuckeliana (strain B05.10)
A1D1U0 3.83e-09 61 26 6 179 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
P53720 4.22e-09 60 29 4 178 1 SMM1 tRNA-dihydrouridine(20) synthase [NAD(P)+] Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q2HDP2 5.37e-09 60 28 7 178 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
Q6CWM0 7.05e-09 60 27 5 166 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q6C4K3 8.22e-09 60 26 7 181 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Yarrowia lipolytica (strain CLIB 122 / E 150)
Q4WRX4 9.04e-09 60 26 6 179 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q0CZL3 1.39e-08 59 26 6 179 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A7EKL8 1.85e-08 59 26 6 180 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)
Q0U9D6 2.01e-08 58 25 5 179 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
Q9PGB5 8.22e-08 56 29 6 179 3 dusA tRNA-dihydrouridine(20/20a) synthase Xylella fastidiosa (strain 9a5c)
Q757E3 2.32e-07 55 25 5 160 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
A7TQ73 3.67e-07 55 24 6 167 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294 / BCRC 21397 / CBS 2163 / NBRC 10782 / NRRL Y-8283 / UCD 57-17)
Q06053 4.29e-07 54 24 5 164 1 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A7A1S5 4.29e-07 54 24 5 164 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Saccharomyces cerevisiae (strain YJM789)
Q87AY2 6.21e-07 53 28 6 179 3 dusA tRNA-dihydrouridine(20/20a) synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q92AH5 6.84e-06 50 27 7 186 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8Y667 8.75e-06 50 27 7 186 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
O27281 1.04e-05 50 21 8 213 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
B8DDR9 1.47e-05 49 27 7 186 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Listeria monocytogenes serotype 4a (strain HCC23)
A0AJT8 1.74e-05 49 27 7 186 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q8CWG1 1.88e-05 49 29 7 161 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
C1KWD2 2.62e-05 48 27 7 186 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Listeria monocytogenes serotype 4b (strain CLIP80459)
Q71YI3 2.67e-05 48 27 7 186 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Listeria monocytogenes serotype 4b (strain F2365)
P32370 4.72e-05 48 24 4 204 1 baiH 7-beta-hydroxy-3-oxochol-24-oyl-CoA 4-desaturase Clostridium scindens (strain JCM 10418 / VPI 12708)
B1YIR7 0.000123 46 26 7 182 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_09520
Feature type CDS
Gene dusC
Product tRNA dihydrouridine(16) synthase DusC
Location 1814 - 2746 (strand: -1)
Length 933 (nucleotides) / 310 (amino acids)

Contig

Accession contig_11
Length 143616 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_87
Orthogroup size 12
N. genomes 7

Actions

Genomic region

Domains

PF01207 Dihydrouridine synthase (Dus)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0042 Translation, ribosomal structure and biogenesis (J) J tRNA-dihydrouridine synthase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05541 tRNA-dihydrouridine synthase C [EC:1.-.-.-] - -

Protein Sequence

MRVLLAPMEGVLDSLVREILSEVNDYDLCITEFLRVVDQLLPVKSFYRICPELYNKSCTLSGTLVRIQLLGQFPEWLAENAARAIELGSYGVDLNCGCPSKVVNGSGGGATLLKDPELIYKATKAIREAVPSELPVTVKIRLGWDSNEQKFEIADAVEQAGATELTIHGRTKEDGYKAERINWQAICEIRKRLTIPVIANGEIWDYSSSQKCLEITGCDAVMLGRGALNIPNLSRVVKYNEPKMDWLGVTKLLKKYIQLEKQGDTGLYHVARIKQWLGYLRKEYSEALELFTEIRQLKTSKEIAQIIQSI

Flanking regions ( +/- flanking 50bp)

GATTAAGTGAAAATTAATCAATATTAATGTGGTAGTTTGCGAGAATTTGTATGCGCGTGTTACTAGCTCCAATGGAAGGCGTTCTTGACTCTTTAGTTAGAGAAATTTTAAGTGAAGTAAATGACTATGACTTATGTATTACTGAATTTTTACGTGTTGTAGATCAGTTACTTCCAGTTAAATCCTTTTATCGGATTTGCCCTGAACTATATAATAAAAGTTGTACACTATCAGGAACGTTAGTGCGTATTCAGTTACTTGGACAGTTTCCTGAATGGTTGGCTGAAAATGCGGCTAGAGCTATAGAACTAGGTTCATATGGCGTCGATTTGAATTGCGGCTGTCCGTCAAAAGTGGTGAATGGCAGTGGTGGTGGAGCTACATTACTCAAAGACCCTGAGTTAATATATAAAGCGACTAAAGCAATACGTGAGGCTGTTCCTAGCGAGCTCCCTGTAACAGTAAAAATACGTTTAGGATGGGATTCTAATGAACAAAAGTTTGAAATAGCAGATGCTGTTGAACAGGCTGGTGCAACGGAACTTACGATTCATGGGCGAACAAAAGAGGATGGTTACAAAGCTGAACGTATTAATTGGCAAGCTATCTGCGAAATTCGTAAAAGGTTAACAATTCCTGTTATTGCAAATGGCGAAATTTGGGATTACTCAAGTTCTCAAAAGTGTTTAGAAATTACAGGTTGTGATGCCGTAATGTTAGGAAGAGGAGCATTAAATATTCCAAACCTCAGCCGGGTAGTGAAATATAATGAGCCTAAAATGGATTGGTTGGGTGTGACTAAGTTATTGAAAAAATACATACAACTAGAAAAACAAGGAGATACAGGTCTGTATCATGTTGCTCGTATCAAACAATGGCTAGGTTATTTGCGTAAAGAGTATAGTGAGGCATTGGAGCTATTCACAGAAATTAGACAATTAAAAACGTCAAAAGAAATAGCACAAATCATCCAATCTATATGAGAAAAAAATTGGATATCAAAATTCCATAGATATCTTTAAATTCCAGCAAG