Homologs in group_1466

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_10005 EHELCC_10005 100.0 Morganella morganii S2 potC spermidine/putrescine ABC transporter permease PotC
NLDBIP_10350 NLDBIP_10350 100.0 Morganella morganii S4 potC spermidine/putrescine ABC transporter permease PotC
LHKJJB_11005 LHKJJB_11005 100.0 Morganella morganii S3 potC spermidine/putrescine ABC transporter permease PotC
HKOGLL_14065 HKOGLL_14065 100.0 Morganella morganii S5 potC spermidine/putrescine ABC transporter permease PotC
F4V73_RS10560 F4V73_RS10560 96.9 Morganella psychrotolerans potC spermidine/putrescine ABC transporter permease PotC
PMI_RS13480 PMI_RS13480 88.0 Proteus mirabilis HI4320 potC spermidine/putrescine ABC transporter permease PotC

Distribution of the homologs in the orthogroup group_1466

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1466

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AFK6 8.63e-157 439 88 0 257 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli (strain K12)
P0AFK7 8.63e-157 439 88 0 257 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFK8 8.63e-157 439 88 0 257 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli O157:H7
Q83RR7 1.31e-156 439 88 0 257 3 potC Spermidine/putrescine transport system permease protein PotC Shigella flexneri
P45169 4.5e-124 356 68 0 252 3 potC Spermidine/putrescine transport system permease protein PotC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AFL1 3.59e-51 171 39 3 253 1 potI Putrescine transport system permease protein PotI Escherichia coli (strain K12)
P0AFL2 3.59e-51 171 39 3 253 3 potI Putrescine transport system permease protein PotI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFS0 1.17e-23 99 30 3 246 3 ydcV Inner membrane ABC transporter permease protein YdcV Shigella flexneri
P0AFR9 1.17e-23 99 30 3 246 1 ydcV Inner membrane ABC transporter permease protein YdcV Escherichia coli (strain K12)
P75057 2.93e-22 96 29 7 269 3 potC Spermidine/putrescine transport system permease protein PotC homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47290 5.52e-20 90 26 8 271 3 potC Spermidine/putrescine transport system permease protein PotC homolog Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P41032 8.63e-14 72 29 2 206 3 cysU Sulfate transport system permease protein CysT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45322 1.33e-12 68 29 5 186 3 modB Molybdenum transport system permease protein ModB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P16701 3.4e-12 68 28 4 207 3 cysU Sulfate transport system permease protein CysT Escherichia coli (strain K12)
Q5PFQ5 3.49e-12 68 23 4 262 3 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z8X0 1.29e-11 66 24 4 250 3 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella typhi
P9WG01 4.5e-11 65 26 0 157 1 sugB Trehalose transport system permease protein SugB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG00 4.5e-11 65 26 0 157 3 sugB Trehalose transport system permease protein SugB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P96065 6.35e-11 64 23 4 262 2 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57SD8 1.58e-10 63 23 4 262 3 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella choleraesuis (strain SC-B67)
P56343 6.61e-10 61 26 3 172 3 cysT Probable sulfate transport system permease protein cysT Chlorella vulgaris
Q9TJR4 1.36e-09 60 26 2 153 3 cysT Probable sulfate transport system permease protein cysT Prototheca wickerhamii
Q2EEX6 1.94e-09 60 26 3 171 3 cysT Probable sulfate transport system permease protein cysT Helicosporidium sp. subsp. Simulium jonesii
P45170 2.47e-09 60 42 0 69 3 potB Spermidine/putrescine transport system permease protein PotB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AFK5 3.3e-09 59 29 4 185 3 potB Spermidine/putrescine transport system permease protein PotB Shigella flexneri
P0AFK4 3.3e-09 59 29 4 185 1 potB Spermidine/putrescine transport system permease protein PotB Escherichia coli (strain K12)
P0CL49 1.53e-08 57 28 4 185 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WF94 1.53e-08 57 28 4 185 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhimurium (strain SL1344)
P0A2J8 1.53e-08 57 28 4 185 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhi
P77156 1.94e-08 57 25 7 255 1 ydcU Inner membrane ABC transporter permease protein YdcU Escherichia coli (strain K12)
D4GQ17 2.67e-08 57 26 1 160 3 HVO_B0370 Probable molybdenum ABC transporter permease protein HVO_B0370 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
O07011 3.42e-08 56 25 3 211 1 ganQ Galactooligosaccharides transport system permease protein GanQ Bacillus subtilis (strain 168)
O58760 4.44e-08 56 27 1 154 3 PH1036 Probable ABC transporter permease protein PH1036 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
O06991 6.02e-08 55 23 2 210 3 mdxG Maltodextrin transport system permease protein MdxG Bacillus subtilis (strain 168)
Q9MUL9 9.56e-08 55 25 7 208 3 cysT Probable sulfate transport system permease protein cysT Mesostigma viride
P0AF01 1.11e-07 54 30 3 122 1 modB Molybdenum transport system permease protein ModB Escherichia coli (strain K12)
P0AF02 1.11e-07 54 30 3 122 3 modB Molybdenum transport system permease protein ModB Escherichia coli O157:H7
O57893 2.3e-07 53 27 3 202 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P55452 1.01e-06 52 24 3 186 3 NGR_a03680 Probable ABC transporter permease protein y4fN Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P55452 2e-05 48 26 3 165 3 NGR_a03680 Probable ABC transporter permease protein y4fN Sinorhizobium fredii (strain NBRC 101917 / NGR234)
O32154 2.06e-06 51 21 6 187 3 yurM Probable ABC transporter permease protein YurM Bacillus subtilis (strain 168)
Q57SD7 2.5e-06 51 31 0 89 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella choleraesuis (strain SC-B67)
Q58763 2.57e-06 50 22 3 201 3 wtpB Molybdate/tungstate transport system permease protein WtpB Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P96064 2.59e-06 51 31 0 89 2 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9TKU8 2.93e-06 50 26 3 156 3 cysT Probable sulfate transport system permease protein cysT Nephroselmis olivacea
Q5PFQ6 3.07e-06 50 31 0 89 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A2CI71 4.04e-06 50 25 6 201 3 cysT Probable sulfate transport system permease protein cysT Chlorokybus atmophyticus
O31520 6.08e-06 50 24 3 177 3 yesQ Probable ABC transporter permease protein YesQ Bacillus subtilis (strain 168)
O30143 1.28e-05 48 27 4 168 1 wtpB Molybdate/tungstate transport system permease protein WtpB Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P26246 1.5e-05 48 27 1 155 3 cysT Probable sulfate transport system permease protein cysT Marchantia polymorpha
O34742 1.5e-05 48 23 3 161 1 opuCD Glycine betaine/carnitine/choline transport system permease protein OpuCD Bacillus subtilis (strain 168)
P77716 1.59e-05 48 26 1 146 1 ycjP Inner membrane ABC transporter permease protein YcjP Escherichia coli (strain K12)
Q55473 2.05e-05 48 22 0 172 1 ggtD Osmoprotective compounds uptake permease protein GgtD Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8Z8W9 2.52e-05 48 30 0 89 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhi
Q6QJE2 2.73e-05 48 25 1 168 1 SULP2 Sulfate permease 2, chloroplastic Chlamydomonas reinhardtii
Q9KTJ6 4.54e-05 47 24 3 150 3 metI Probable D-methionine transport system permease protein MetI Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9V2C1 5.19e-05 47 25 2 152 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus abyssi (strain GE5 / Orsay)
P31547 5.51e-05 46 27 3 140 1 metI D-methionine transport system permease protein MetI Escherichia coli (strain K12)
Q8Z991 5.99e-05 46 27 3 140 3 metI D-methionine transport system permease protein MetI Salmonella typhi
Q8ZRN0 6.1e-05 46 27 3 140 3 metI D-methionine transport system permease protein MetI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q32RF7 6.3e-05 47 23 4 196 3 cysT Probable sulfate transport system permease protein cysT Zygnema circumcarinatum
Q7LYX6 6.72e-05 47 29 6 168 1 malG Trehalose/maltose transport system permease protein MalG Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
Q8X800 8.24e-05 46 27 3 140 3 metI D-methionine transport system permease protein MetI Escherichia coli O157:H7
P0A4N4 9.6e-05 46 24 1 178 3 malD Maltodextrin transport system permease protein MalD Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4N3 9.6e-05 46 24 1 178 3 malD Maltodextrin transport system permease protein MalD Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q87GB8 0.000113 46 26 2 149 3 malG Maltose/maltodextrin transport system permease protein MalG Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KL07 0.000121 46 26 2 149 3 malG Maltose/maltodextrin transport system permease protein MalG Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P31135 0.000123 46 33 0 71 1 potH Putrescine transport system permease protein PotH Escherichia coli (strain K12)
Q5JEB3 0.000139 45 23 3 191 3 wtpB Molybdate/tungstate transport system permease protein WtpB Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q7MFC1 0.000151 45 26 2 149 3 malG Maltose/maltodextrin transport system permease protein MalG Vibrio vulnificus (strain YJ016)
Q8D3U7 0.000151 45 26 2 149 3 malG Maltose/maltodextrin transport system permease protein MalG Vibrio vulnificus (strain CMCP6)
P37729 0.00016 45 28 5 217 3 amyC Probable starch degradation products transport system permease protein AmyC Thermoanaerobacterium thermosulfurigenes
Q8ZH39 0.000181 45 32 0 67 3 metI D-methionine transport system permease protein MetI Yersinia pestis
Q9KHT6 0.000321 44 24 3 162 1 opuCD Carnitine transport permease protein OpuCD Listeria monocytogenes
G2JZ41 0.000321 44 24 3 162 1 opuCD Carnitine transport permease protein OpuCD Listeria monocytogenes serotype 1/2a (strain 10403S)
Q7CS31 0.00034 44 23 1 158 1 smoH Sulfoquinovosyl glycerol transport system permease protein SmoH Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9Z3R7 0.000373 45 28 2 166 3 aglG Alpha-glucoside transport system permease protein AglG Rhizobium meliloti (strain 1021)
Q74RF8 0.000385 44 25 2 151 3 malG Maltose/maltodextrin transport system permease protein MalG Yersinia pestis
O50501 0.000445 44 27 3 123 1 ngcG Diacetylchitobiose uptake system permease protein NgcG Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q53683 0.000597 43 23 1 159 3 None Putative ABC transporter permease protein ORF1 (Fragment) Streptomyces antibioticus
Q9K489 0.000667 43 24 2 160 1 dasC Diacetylchitobiose uptake system permease protein DasC Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P68186 0.000859 43 26 2 149 3 malG Maltose/maltodextrin transport system permease protein MalG Shigella flexneri
P68183 0.000859 43 26 2 149 1 malG Maltose/maltodextrin transport system permease protein MalG Escherichia coli (strain K12)
P68184 0.000859 43 26 2 149 3 malG Maltose/maltodextrin transport system permease protein MalG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P68185 0.000859 43 26 2 149 3 malG Maltose/maltodextrin transport system permease protein MalG Escherichia coli O157:H7
Q8U4K4 0.000866 43 27 3 145 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P40980 0.001 43 21 6 243 3 None Putative ABC transporter permease protein ORF2 Caldicellulosiruptor sp. (strain Rt8B.4)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_09405
Feature type CDS
Gene potC
Product spermidine/putrescine ABC transporter permease PotC
Location 110728 - 111510 (strand: -1)
Length 783 (nucleotides) / 260 (amino acids)

Contig

Accession contig_10
Length 146103 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1466
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1177 Amino acid transport and metabolism (E) E ABC-type spermidine/putrescine transport system, permease component II

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11070 spermidine/putrescine transport system permease protein ABC transporters -

Protein Sequence

MIGRLLRGGFMTIIYAYLYIPIVILIVNSFNSSRFGINWQGFTTDWYSTLVNNDSLLQAAGHSLTMAILSATFATVIGSLTAVALYRYRFKGKPFVGGMLFVVMMSPDIVMAISLLVLFMILGVSLGFWSLLFSHITFCLPFVVVTVYSRLKDFDVKMLEAARDLGAGEFTILRKIILPLALPAVIAGWLLSFTLSMDDVVVSSFVTGPSYEILPLKIYSMVKVGVSPEVNALATILMALSLFMVIISQLVLRDRSHKQQ

Flanking regions ( +/- flanking 50bp)

TATGTCTATTACCGTGCGGCAAAAATGTTAAATAAGAAGGGTGAACTGGAATGATAGGACGCCTGTTACGCGGTGGTTTTATGACCATCATCTATGCTTATTTATACATCCCGATTGTCATTCTGATTGTGAACTCCTTTAACTCATCCCGTTTCGGGATCAACTGGCAGGGGTTCACGACTGACTGGTACAGCACACTGGTCAATAATGACAGCCTGTTGCAGGCGGCGGGCCATTCACTGACGATGGCGATTCTGTCTGCCACATTTGCCACGGTTATCGGTTCACTGACAGCGGTGGCACTGTACCGCTACCGGTTCAAAGGAAAACCGTTTGTCGGCGGCATGCTGTTTGTGGTGATGATGTCACCGGATATCGTGATGGCAATCTCCCTGTTGGTACTGTTTATGATCCTCGGGGTGTCGCTCGGTTTCTGGTCATTGTTGTTCTCGCACATTACCTTCTGCCTGCCGTTTGTGGTGGTCACGGTCTATTCGCGGCTGAAAGATTTTGACGTGAAAATGCTGGAAGCGGCACGGGATCTGGGCGCCGGGGAATTTACCATTCTGCGCAAGATTATTTTGCCGCTGGCGTTACCGGCGGTGATTGCGGGCTGGCTGCTGAGCTTTACCCTGTCGATGGATGACGTGGTGGTTTCCTCATTTGTTACCGGGCCGAGCTATGAAATTCTGCCGCTGAAAATCTATTCGATGGTAAAAGTCGGGGTTTCACCGGAAGTGAATGCGCTGGCCACGATTTTAATGGCACTTTCGCTGTTTATGGTCATCATCAGTCAGCTTGTGCTGCGTGACCGCTCACACAAACAGCAGTAACCTTTCTGTTACCGGCGCGGTCTTCAGCGGATCCGCCGGTTTATTTTGTG