Homologs in group_1518

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09405 FBDBKF_09405 96.9 Morganella morganii S1 potC spermidine/putrescine ABC transporter permease PotC
EHELCC_10005 EHELCC_10005 96.9 Morganella morganii S2 potC spermidine/putrescine ABC transporter permease PotC
NLDBIP_10350 NLDBIP_10350 96.9 Morganella morganii S4 potC spermidine/putrescine ABC transporter permease PotC
LHKJJB_11005 LHKJJB_11005 96.9 Morganella morganii S3 potC spermidine/putrescine ABC transporter permease PotC
HKOGLL_14065 HKOGLL_14065 96.9 Morganella morganii S5 potC spermidine/putrescine ABC transporter permease PotC
PMI_RS13480 PMI_RS13480 87.3 Proteus mirabilis HI4320 potC spermidine/putrescine ABC transporter permease PotC

Distribution of the homologs in the orthogroup group_1518

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1518

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AFK6 7.32e-156 437 88 0 257 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli (strain K12)
P0AFK7 7.32e-156 437 88 0 257 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFK8 7.32e-156 437 88 0 257 3 potC Spermidine/putrescine transport system permease protein PotC Escherichia coli O157:H7
Q83RR7 1.28e-155 436 88 0 257 3 potC Spermidine/putrescine transport system permease protein PotC Shigella flexneri
P45169 4.98e-125 358 68 0 257 3 potC Spermidine/putrescine transport system permease protein PotC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AFL1 6.99e-51 171 40 3 252 1 potI Putrescine transport system permease protein PotI Escherichia coli (strain K12)
P0AFL2 6.99e-51 171 40 3 252 3 potI Putrescine transport system permease protein PotI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFS0 1.01e-23 99 30 3 246 3 ydcV Inner membrane ABC transporter permease protein YdcV Shigella flexneri
P0AFR9 1.01e-23 99 30 3 246 1 ydcV Inner membrane ABC transporter permease protein YdcV Escherichia coli (strain K12)
P75057 1.67e-22 96 30 6 259 3 potC Spermidine/putrescine transport system permease protein PotC homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47290 6.23e-20 89 27 7 258 3 potC Spermidine/putrescine transport system permease protein PotC homolog Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P41032 5.37e-13 70 28 2 206 3 cysU Sulfate transport system permease protein CysT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45322 1.08e-12 68 30 5 186 3 modB Molybdenum transport system permease protein ModB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P16701 9.26e-12 67 28 4 207 3 cysU Sulfate transport system permease protein CysT Escherichia coli (strain K12)
Q5PFQ5 1.78e-11 65 23 4 262 3 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z8X0 4.35e-11 64 24 4 250 3 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella typhi
P9WG01 4.82e-11 64 26 0 157 1 sugB Trehalose transport system permease protein SugB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG00 4.82e-11 64 26 0 157 3 sugB Trehalose transport system permease protein SugB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P96065 2.81e-10 62 23 4 262 2 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57SD8 5.73e-10 61 23 4 262 3 phnV Putative 2-aminoethylphosphonate transport system permease protein PhnV Salmonella choleraesuis (strain SC-B67)
P56343 5.78e-10 61 26 3 172 3 cysT Probable sulfate transport system permease protein cysT Chlorella vulgaris
Q2EEX6 1.11e-09 60 26 3 171 3 cysT Probable sulfate transport system permease protein cysT Helicosporidium sp. subsp. Simulium jonesii
Q9TJR4 1.8e-09 60 26 2 153 3 cysT Probable sulfate transport system permease protein cysT Prototheca wickerhamii
P45170 2.52e-09 60 42 0 69 3 potB Spermidine/putrescine transport system permease protein PotB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AFK5 3.77e-09 59 29 4 185 3 potB Spermidine/putrescine transport system permease protein PotB Shigella flexneri
P0AFK4 3.77e-09 59 29 4 185 1 potB Spermidine/putrescine transport system permease protein PotB Escherichia coli (strain K12)
P0CL49 2.17e-08 57 28 4 185 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WF94 2.17e-08 57 28 4 185 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhimurium (strain SL1344)
P0A2J8 2.17e-08 57 28 4 185 3 potB Spermidine/putrescine transport system permease protein PotB Salmonella typhi
P77156 2.24e-08 57 36 0 74 1 ydcU Inner membrane ABC transporter permease protein YdcU Escherichia coli (strain K12)
P0AF01 2.87e-08 56 30 3 122 1 modB Molybdenum transport system permease protein ModB Escherichia coli (strain K12)
P0AF02 2.87e-08 56 30 3 122 3 modB Molybdenum transport system permease protein ModB Escherichia coli O157:H7
O58760 6.59e-08 55 26 1 154 3 PH1036 Probable ABC transporter permease protein PH1036 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9MUL9 6.62e-08 55 24 8 231 3 cysT Probable sulfate transport system permease protein cysT Mesostigma viride
O06991 7.68e-08 55 24 2 201 3 mdxG Maltodextrin transport system permease protein MdxG Bacillus subtilis (strain 168)
O07011 8.28e-08 55 26 2 185 1 ganQ Galactooligosaccharides transport system permease protein GanQ Bacillus subtilis (strain 168)
D4GQ17 1.1e-07 55 26 1 157 3 HVO_B0370 Probable molybdenum ABC transporter permease protein HVO_B0370 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q58763 5.78e-07 52 24 4 201 3 wtpB Molybdate/tungstate transport system permease protein WtpB Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O32154 1.47e-06 52 21 6 187 3 yurM Probable ABC transporter permease protein YurM Bacillus subtilis (strain 168)
P55452 1.55e-06 52 24 3 186 3 NGR_a03680 Probable ABC transporter permease protein y4fN Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P55452 6.99e-05 47 26 3 154 3 NGR_a03680 Probable ABC transporter permease protein y4fN Sinorhizobium fredii (strain NBRC 101917 / NGR234)
O57893 2.18e-06 51 26 3 202 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q57SD7 2.69e-06 51 31 0 89 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella choleraesuis (strain SC-B67)
P96064 2.87e-06 50 31 0 89 2 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PFQ6 2.96e-06 50 31 0 89 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q9TKU8 4.2e-06 50 26 3 156 3 cysT Probable sulfate transport system permease protein cysT Nephroselmis olivacea
A2CI71 4.96e-06 50 25 6 201 3 cysT Probable sulfate transport system permease protein cysT Chlorokybus atmophyticus
O30143 1.13e-05 48 27 4 169 1 wtpB Molybdate/tungstate transport system permease protein WtpB Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O34742 1.17e-05 48 24 3 161 1 opuCD Glycine betaine/carnitine/choline transport system permease protein OpuCD Bacillus subtilis (strain 168)
Q55473 1.75e-05 48 22 0 172 1 ggtD Osmoprotective compounds uptake permease protein GgtD Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P77716 1.86e-05 48 27 1 141 1 ycjP Inner membrane ABC transporter permease protein YcjP Escherichia coli (strain K12)
P26246 1.99e-05 48 27 1 155 3 cysT Probable sulfate transport system permease protein cysT Marchantia polymorpha
Q9KTJ6 2.05e-05 48 24 3 150 3 metI Probable D-methionine transport system permease protein MetI Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8Z8W9 2.41e-05 48 30 0 89 3 phnU Putative 2-aminoethylphosphonate transport system permease protein PhnU Salmonella typhi
O31520 3.22e-05 47 24 3 177 3 yesQ Probable ABC transporter permease protein YesQ Bacillus subtilis (strain 168)
Q6QJE2 4.34e-05 47 25 1 168 1 SULP2 Sulfate permease 2, chloroplastic Chlamydomonas reinhardtii
P31547 5.66e-05 46 27 3 140 1 metI D-methionine transport system permease protein MetI Escherichia coli (strain K12)
Q9V2C1 6.02e-05 47 25 2 152 3 wtpB Molybdate/tungstate transport system permease protein WtpB Pyrococcus abyssi (strain GE5 / Orsay)
Q8Z991 6.52e-05 46 27 3 140 3 metI D-methionine transport system permease protein MetI Salmonella typhi
Q8ZRN0 7.29e-05 46 27 3 140 3 metI D-methionine transport system permease protein MetI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q32RF7 8.92e-05 46 24 3 169 3 cysT Probable sulfate transport system permease protein cysT Zygnema circumcarinatum
Q7LYX6 9.02e-05 46 30 3 142 1 malG Trehalose/maltose transport system permease protein MalG Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
Q87GB8 9.07e-05 46 26 2 149 3 malG Maltose/maltodextrin transport system permease protein MalG Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8X800 9.84e-05 45 27 3 140 3 metI D-methionine transport system permease protein MetI Escherichia coli O157:H7
Q9KL07 0.00011 46 26 2 149 3 malG Maltose/maltodextrin transport system permease protein MalG Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P31135 0.00012 46 33 0 71 1 potH Putrescine transport system permease protein PotH Escherichia coli (strain K12)
Q7MFC1 0.000122 46 26 2 149 3 malG Maltose/maltodextrin transport system permease protein MalG Vibrio vulnificus (strain YJ016)
Q8D3U7 0.000122 46 26 2 149 3 malG Maltose/maltodextrin transport system permease protein MalG Vibrio vulnificus (strain CMCP6)
P0A4N4 0.000131 45 24 1 178 3 malD Maltodextrin transport system permease protein MalD Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4N3 0.000131 45 24 1 178 3 malD Maltodextrin transport system permease protein MalD Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q5JEB3 0.000153 45 23 3 191 3 wtpB Molybdate/tungstate transport system permease protein WtpB Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q8ZH39 0.000189 45 32 0 67 3 metI D-methionine transport system permease protein MetI Yersinia pestis
Q74RF8 0.00045 44 25 2 151 3 malG Maltose/maltodextrin transport system permease protein MalG Yersinia pestis
Q9Z3R7 0.000452 44 26 1 167 3 aglG Alpha-glucoside transport system permease protein AglG Rhizobium meliloti (strain 1021)
Q7CS31 0.000468 44 23 1 158 1 smoH Sulfoquinovosyl glycerol transport system permease protein SmoH Agrobacterium fabrum (strain C58 / ATCC 33970)
O50501 0.000514 44 27 3 123 1 ngcG Diacetylchitobiose uptake system permease protein NgcG Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P68186 0.000749 43 26 2 149 3 malG Maltose/maltodextrin transport system permease protein MalG Shigella flexneri
P68183 0.000749 43 26 2 149 1 malG Maltose/maltodextrin transport system permease protein MalG Escherichia coli (strain K12)
P68184 0.000749 43 26 2 149 3 malG Maltose/maltodextrin transport system permease protein MalG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P68185 0.000749 43 26 2 149 3 malG Maltose/maltodextrin transport system permease protein MalG Escherichia coli O157:H7
P94530 0.000764 43 28 8 189 1 araQ Arabinooligosaccharides transport system permease protein AraQ Bacillus subtilis (strain 168)
P39775 0.000819 43 23 3 155 2 opuBD Choline transport system permease protein OpuBD Bacillus subtilis (strain 168)
P74547 0.000823 43 23 3 177 3 cysW Sulfate transport system permease protein CysW Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P37729 0.001 43 27 5 222 3 amyC Probable starch degradation products transport system permease protein AmyC Thermoanaerobacterium thermosulfurigenes
Q9KHT6 0.001 43 23 1 138 1 opuCD Carnitine transport permease protein OpuCD Listeria monocytogenes
G2JZ41 0.001 43 23 1 138 1 opuCD Carnitine transport permease protein OpuCD Listeria monocytogenes serotype 1/2a (strain 10403S)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS10560
Feature type CDS
Gene potC
Product spermidine/putrescine ABC transporter permease PotC
Location 243585 - 244367 (strand: 1)
Length 783 (nucleotides) / 260 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1518
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1177 Amino acid transport and metabolism (E) E ABC-type spermidine/putrescine transport system, permease component II

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11070 spermidine/putrescine transport system permease protein ABC transporters -

Protein Sequence

MTGRLLRGGFMTIIYAYLYIPIIILIVNSFNSSRFGINWQGFTTDWYSMLMNNDSLLQAAGHSLTMAVLSATFATVIGSLTAVALYRYRFKGKPFVGGMLFVVMMSPDIVMAISLLVLFMILGVSLGFWSLLFSHITFCLPFVVVTVYSRLKDFDVKMLEAARDLGAGEFTILRKIILPLALPAVIAGWLLSFTLSMDDVVVSSFVTGPSYEILPLKIYSMVKVGVSPEVNALATILMALSLFMVILSQLVLRTSSHKQQ

Flanking regions ( +/- flanking 50bp)

TGGGTCTACTACCGTGCGGCAAAATTGTTAAATAAGAAAGGTGAACAGGAATGACGGGACGCCTGTTGCGTGGTGGTTTTATGACCATCATTTATGCTTATTTATACATCCCGATTATCATTCTGATTGTGAATTCCTTTAATTCATCCCGCTTCGGAATCAACTGGCAGGGCTTTACCACCGACTGGTACAGCATGCTGATGAACAATGACAGCCTGCTTCAGGCGGCAGGACATTCACTGACGATGGCGGTTCTCTCTGCCACATTTGCCACCGTTATCGGTTCGCTGACAGCAGTCGCGCTCTACCGCTATCGTTTTAAAGGTAAACCGTTTGTCGGTGGCATGTTGTTTGTGGTGATGATGTCACCGGACATTGTGATGGCGATTTCACTGCTGGTACTGTTTATGATCCTCGGGGTATCGCTGGGGTTCTGGTCGCTGCTCTTTTCACACATCACATTTTGCCTGCCGTTTGTGGTGGTCACGGTTTATTCACGACTGAAAGATTTTGATGTGAAAATGCTGGAGGCGGCGCGTGATCTCGGTGCCGGTGAATTTACAATTTTGCGTAAAATTATTCTGCCGCTGGCGTTACCGGCCGTTATTGCAGGCTGGTTACTGAGCTTTACCCTCTCGATGGATGATGTGGTGGTATCTTCATTTGTCACCGGGCCAAGCTATGAGATTCTGCCGCTGAAAATTTACTCTATGGTAAAAGTCGGCGTTTCGCCGGAAGTAAATGCATTAGCGACGATTTTAATGGCTCTTTCGTTATTTATGGTGATCCTCAGCCAGCTTGTGTTGCGTACCAGCTCACACAAACAGCAATAGCCTTTGCTTAACCGGCGCGGTCTGTCGCAGATCCGCCGGTTAATATTCAC