Homologs in group_409

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_10380 EHELCC_10380 100.0 Morganella morganii S2 fimC P pilus assembly protein, chaperone PapD
NLDBIP_10725 NLDBIP_10725 100.0 Morganella morganii S4 fimC P pilus assembly protein, chaperone PapD
LHKJJB_10630 LHKJJB_10630 100.0 Morganella morganii S3 fimC P pilus assembly protein, chaperone PapD
HKOGLL_13690 HKOGLL_13690 100.0 Morganella morganii S5 fimC P pilus assembly protein, chaperone PapD
F4V73_RS10940 F4V73_RS10940 86.4 Morganella psychrotolerans - fimbria/pilus periplasmic chaperone
PMI_RS01290 PMI_RS01290 72.2 Proteus mirabilis HI4320 mrpD MR/P fimbria assembly chaperone MrpD

Distribution of the homologs in the orthogroup group_409

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_409

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P15319 2.72e-83 251 51 5 245 1 papD Chaperone protein PapD Escherichia coli
P77599 6.86e-81 246 53 2 218 2 yfcS Probable fimbrial chaperone YfcS Escherichia coli (strain K12)
P53520 5.6e-69 216 43 4 239 3 pmfD Chaperone protein PmfD Proteus mirabilis (strain HI4320)
P75749 1.55e-51 171 39 6 238 3 ybgP Uncharacterized fimbrial chaperone YbgP Escherichia coli (strain K12)
P77616 1.87e-44 153 37 6 236 3 yqiH Uncharacterized fimbrial chaperone YqiH Escherichia coli (strain K12)
P33409 4.11e-33 123 34 10 241 3 fimB Chaperone protein FimB/FhaD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8X5K6 2.01e-32 121 31 8 240 2 lpfB Probable fimbrial chaperone LpfB Escherichia coli O157:H7
P21646 2.06e-32 121 33 9 229 3 mrkB Chaperone protein MrkB Klebsiella pneumoniae
P42914 1.13e-31 119 33 10 246 2 yraI Probable fimbrial chaperone YraI Escherichia coli (strain K12)
P43661 2.61e-31 118 33 8 228 3 lpfB Chaperone protein LpfB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37923 1.04e-30 117 35 7 214 3 fimC Chaperone protein FimC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P75856 5.91e-29 112 31 9 234 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli (strain K12)
Q8X5E4 9.32e-29 112 31 9 234 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli O157:H7
P62609 1.15e-28 111 33 7 225 1 focC Chaperone protein FocC Escherichia coli
P62610 1.15e-28 111 33 7 225 3 focC Chaperone protein FocC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P33128 5.18e-28 110 33 10 245 1 yadV Probable fimbrial chaperone YadV Escherichia coli (strain K12)
P42183 9.3e-27 103 45 4 124 3 prsD Chaperone protein PrsD (Fragment) Escherichia coli
P45991 2.84e-24 100 30 6 236 3 hifB Chaperone protein HifB Haemophilus influenzae
P33342 2.9e-24 100 32 9 229 2 yehC Probable fimbrial chaperone YehC Escherichia coli (strain K12)
P35757 1.02e-23 99 30 6 236 3 hifB Chaperone protein HifB Haemophilus influenzae
P31697 1.38e-23 98 32 8 217 1 fimC Chaperone protein FimC Escherichia coli (strain K12)
P59590 1.58e-23 98 32 8 217 3 fimC Chaperone protein FimC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P77249 1.62e-23 98 30 8 233 2 sfmC Probable fimbrial chaperone SfmC Escherichia coli (strain K12)
P25401 7.79e-23 97 32 10 225 1 faeE Chaperone protein FaeE Escherichia coli
P25402 3.22e-22 94 33 11 227 3 fanE Chaperone protein FanE Escherichia coli
Q05433 1.64e-20 90 30 8 220 3 clpE Chaperone protein ClpE Escherichia coli
P69966 5.55e-15 75 27 11 241 3 psaB Chaperone protein PsaB Yersinia pseudotuberculosis serotype I (strain IP32953)
P69965 5.55e-15 75 27 11 241 3 psaB Chaperone protein PsaB Yersinia pestis
P33387 6.69e-12 67 25 5 176 3 sefB Chaperone protein SefB Salmonella enteritidis
P40876 7.57e-12 66 26 8 236 2 ycbF Uncharacterized fimbrial chaperone YcbF Escherichia coli (strain K12)
P26926 2.14e-11 65 25 10 260 1 caf1M Chaperone protein caf1M Yersinia pestis
P53516 4.97e-11 64 27 7 185 3 afaB Chaperone protein AfaB Escherichia coli
P53518 4.35e-10 61 23 8 233 3 cssC Chaperone protein CssC Escherichia coli
P53519 2.05e-09 59 23 8 233 3 cssC Chaperone protein CssC Escherichia coli
P15483 1.35e-08 57 29 10 210 3 None Chaperone protein CS3-1 Escherichia coli
P46738 2.89e-08 56 26 8 185 3 nfaE Chaperone protein NfaE Escherichia coli
P33407 5.64e-08 55 22 10 238 3 myfB Chaperone protein MyfB Yersinia enterocolitica
P46004 1.51e-07 54 24 7 200 3 aggD Chaperone protein AggD Escherichia coli

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_09030
Feature type CDS
Gene fimC
Product P pilus assembly protein, chaperone PapD
Location 19854 - 20612 (strand: -1)
Length 759 (nucleotides) / 252 (amino acids)
In genomic island -

Contig

Accession contig_10
Length 146103 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_409
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00345 Pili and flagellar-assembly chaperone, PapD N-terminal domain
PF02753 Pili assembly chaperone PapD, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3121 Extracellular structures (W) W P pilus assembly protein, chaperone PapD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K12519 chaperone protein PapD - -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG042624 MR/P fimbria assembly chaperone MrpD VF1233 Adherence

Protein Sequence

MMSVKQTRLSVLAVAAVLLASAQSHAAIALDRTRVIFNGAEKSVSLNVSNLNKELPYLAQGWIEDQNGEKISSPLVVLPPVQRIEPGDKSQVKIQALPAIAALPQDRESVFYFNLREIPPRSNRQNVLQIALQTRIKLFYRPEAIYASQTDLTNPWQEKITLTRRGDHYEVHNPTAYYVTIVDALSGLGGKSLNGFSPLMVAPKSQGTLGLSAAALGSAPVLSYINDYGGRPQLQFSCSGAECRVTKTAAGN

Flanking regions ( +/- flanking 50bp)

GGCCGGGCAGACCCGGCACCTTCCACACGTAACGAAATGAGTGATTCATTATGATGTCAGTTAAACAAACCCGTCTCTCTGTTCTGGCCGTTGCCGCTGTATTGCTGGCCTCAGCACAGTCGCACGCGGCTATCGCGCTGGACAGAACCCGTGTCATTTTCAACGGGGCAGAGAAATCTGTCAGCCTGAATGTCAGCAATCTGAATAAAGAGCTGCCGTACCTGGCGCAGGGATGGATTGAGGATCAGAACGGAGAAAAAATTTCGTCACCGCTGGTGGTTTTGCCGCCGGTGCAGCGTATTGAGCCGGGTGATAAAAGTCAGGTAAAAATTCAGGCATTACCGGCGATCGCCGCACTGCCGCAGGACAGGGAAAGTGTCTTCTATTTCAATCTGCGGGAAATTCCGCCGCGCAGCAACCGGCAGAATGTCCTGCAAATCGCCCTGCAGACCCGCATCAAACTGTTTTACCGCCCGGAAGCTATCTATGCCTCACAAACGGATCTGACTAATCCGTGGCAGGAAAAAATCACCCTGACGCGCCGTGGTGATCACTATGAAGTCCATAACCCGACTGCGTATTACGTGACGATTGTGGATGCGCTCAGCGGGCTGGGCGGCAAAAGCCTGAACGGGTTCTCCCCGCTGATGGTGGCACCGAAAAGTCAGGGCACACTCGGCCTGAGTGCAGCCGCTCTCGGCAGTGCGCCGGTGCTGAGTTATATCAACGACTACGGCGGCCGCCCGCAGTTGCAGTTCAGTTGCAGCGGCGCAGAGTGCCGTGTGACAAAAACGGCTGCCGGTAACTGAACAGACAGGGGATAAACCATGGATGAGCGGATCAGAAAACAGCGTTTCCT