Homologs in group_409

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09030 FBDBKF_09030 86.4 Morganella morganii S1 fimC P pilus assembly protein, chaperone PapD
EHELCC_10380 EHELCC_10380 86.4 Morganella morganii S2 fimC P pilus assembly protein, chaperone PapD
NLDBIP_10725 NLDBIP_10725 86.4 Morganella morganii S4 fimC P pilus assembly protein, chaperone PapD
LHKJJB_10630 LHKJJB_10630 86.4 Morganella morganii S3 fimC P pilus assembly protein, chaperone PapD
HKOGLL_13690 HKOGLL_13690 86.4 Morganella morganii S5 fimC P pilus assembly protein, chaperone PapD
PMI_RS01290 PMI_RS01290 71.2 Proteus mirabilis HI4320 mrpD MR/P fimbria assembly chaperone MrpD

Distribution of the homologs in the orthogroup group_409

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_409

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P15319 1.34e-83 252 51 5 238 1 papD Chaperone protein PapD Escherichia coli
P77599 9.65e-81 245 53 2 215 2 yfcS Probable fimbrial chaperone YfcS Escherichia coli (strain K12)
P53520 6.31e-73 226 45 4 239 3 pmfD Chaperone protein PmfD Proteus mirabilis (strain HI4320)
P75749 1.48e-51 171 39 6 245 3 ybgP Uncharacterized fimbrial chaperone YbgP Escherichia coli (strain K12)
P77616 1.68e-44 153 37 7 234 3 yqiH Uncharacterized fimbrial chaperone YqiH Escherichia coli (strain K12)
P37923 1.18e-33 124 35 7 228 3 fimC Chaperone protein FimC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P33409 8.45e-33 122 33 11 238 3 fimB Chaperone protein FimB/FhaD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8X5K6 9.31e-33 122 32 7 228 2 lpfB Probable fimbrial chaperone LpfB Escherichia coli O157:H7
P42914 1.97e-31 118 34 8 210 2 yraI Probable fimbrial chaperone YraI Escherichia coli (strain K12)
P43661 6.71e-30 114 33 9 229 3 lpfB Chaperone protein LpfB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P21646 1.58e-28 111 32 8 212 3 mrkB Chaperone protein MrkB Klebsiella pneumoniae
P42183 2.97e-28 107 46 4 121 3 prsD Chaperone protein PrsD (Fragment) Escherichia coli
Q8X5E4 1.35e-27 108 30 8 234 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli O157:H7
P75856 2.55e-27 108 32 9 236 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli (strain K12)
P62609 4.09e-27 107 33 8 224 1 focC Chaperone protein FocC Escherichia coli
P62610 4.09e-27 107 33 8 224 3 focC Chaperone protein FocC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P33342 1.77e-25 103 31 8 226 2 yehC Probable fimbrial chaperone YehC Escherichia coli (strain K12)
P59590 1.86e-24 100 31 9 234 3 fimC Chaperone protein FimC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P33128 2.44e-24 100 32 11 226 1 yadV Probable fimbrial chaperone YadV Escherichia coli (strain K12)
P31697 3.44e-24 100 31 9 234 1 fimC Chaperone protein FimC Escherichia coli (strain K12)
P25402 2.78e-23 97 34 11 229 3 fanE Chaperone protein FanE Escherichia coli
P25401 1.41e-22 96 28 6 222 1 faeE Chaperone protein FaeE Escherichia coli
P45991 1.67e-22 95 29 7 233 3 hifB Chaperone protein HifB Haemophilus influenzae
P77249 2.47e-22 94 29 7 232 2 sfmC Probable fimbrial chaperone SfmC Escherichia coli (strain K12)
P35757 5.42e-22 94 29 6 219 3 hifB Chaperone protein HifB Haemophilus influenzae
Q05433 3.42e-21 92 28 6 222 3 clpE Chaperone protein ClpE Escherichia coli
P69966 5.57e-15 75 29 7 186 3 psaB Chaperone protein PsaB Yersinia pseudotuberculosis serotype I (strain IP32953)
P69965 5.57e-15 75 29 7 186 3 psaB Chaperone protein PsaB Yersinia pestis
P33387 1.71e-12 68 27 6 177 3 sefB Chaperone protein SefB Salmonella enteritidis
P53516 4.51e-12 67 27 5 170 3 afaB Chaperone protein AfaB Escherichia coli
P40876 8.69e-12 66 26 8 232 2 ycbF Uncharacterized fimbrial chaperone YcbF Escherichia coli (strain K12)
P33407 2.18e-10 62 24 9 241 3 myfB Chaperone protein MyfB Yersinia enterocolitica
P46004 9.14e-10 60 24 9 254 3 aggD Chaperone protein AggD Escherichia coli
P15483 1.37e-09 60 30 10 201 3 None Chaperone protein CS3-1 Escherichia coli
P46738 3.48e-09 58 26 6 182 3 nfaE Chaperone protein NfaE Escherichia coli
P53519 3.25e-07 53 24 8 214 3 cssC Chaperone protein CssC Escherichia coli
P53518 1.05e-06 51 22 8 234 3 cssC Chaperone protein CssC Escherichia coli

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS10940
Feature type CDS
Gene -
Product fimbria/pilus periplasmic chaperone
Location 330749 - 331501 (strand: 1)
Length 753 (nucleotides) / 250 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_409
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00345 Pili and flagellar-assembly chaperone, PapD N-terminal domain
PF02753 Pili assembly chaperone PapD, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3121 Extracellular structures (W) W P pilus assembly protein, chaperone PapD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K12519 chaperone protein PapD - -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG042624 MR/P fimbria assembly chaperone MrpD VF1233 Adherence

Protein Sequence

MSVKQISITVLAAAMLTTTIQAQAAIALDRTRIIFNGAEKSVSLNVSNLNKELPYLAQGWIEDQSGQKVSAPLVVLPPVQRIEPGDKSQVKIQAIPDIAALPQDRESVFYFNLREIPPRSNRQNVLQIALQTRIKLFYRPEAIYATQTDLTNPWQEKITLTRRGNNYEVNNPTAYYVTIVDALTGLQGKSLDGFTPLMVAPKSQGTLSLSAAALGNAPVLTYINDYGGRPQLQFSCQGTQCSVAKTAAGN

Flanking regions ( +/- flanking 50bp)

AGCCCTGTTTTATCACCACCCACACGTAACGAAATGAGTGATTCACTATGATGTCAGTTAAACAAATCAGTATTACTGTGCTTGCCGCCGCCATGTTGACGACAACGATACAGGCACAGGCTGCGATTGCCCTGGATCGCACCCGTATCATTTTTAACGGCGCGGAAAAATCCGTCAGTCTGAATGTCAGTAATCTGAATAAAGAACTGCCGTATCTGGCACAGGGCTGGATTGAGGATCAGAGCGGTCAGAAAGTCTCAGCGCCGCTGGTGGTCTTACCGCCGGTGCAGCGTATTGAGCCGGGTGATAAAAGCCAGGTGAAAATTCAGGCGATACCGGACATAGCCGCACTACCACAGGACAGAGAAAGCGTTTTCTATTTTAATCTGCGGGAAATTCCCCCGCGCAGCAACCGGCAGAATGTCCTGCAAATCGCACTGCAAACCCGCATCAAGTTGTTCTACCGCCCGGAGGCGATTTACGCCACACAAACGGATCTGACCAATCCGTGGCAGGAAAAAATCACACTGACCCGCCGGGGAAATAATTATGAAGTCAATAATCCCACTGCGTATTACGTGACCATCGTCGATGCGCTGACCGGGTTACAGGGCAAAAGTCTGGATGGATTTACGCCCCTGATGGTTGCACCAAAAAGTCAGGGAACGCTCAGTCTCAGTGCTGCGGCGCTCGGAAATGCACCGGTTCTGACATACATCAATGATTACGGCGGTCGCCCGCAGTTGCAGTTCAGCTGTCAGGGAACACAGTGCAGTGTGGCAAAAACAGCAGCCGGTAACTGAGCCGACAGGAGATAACCATGGATGAGCGGATAAAAATAGAGCGGGTACGG