Homologs in group_850

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_06925 EHELCC_06925 100.0 Morganella morganii S2 frdC fumarate reductase subunit FrdC
NLDBIP_07250 NLDBIP_07250 100.0 Morganella morganii S4 frdC fumarate reductase subunit FrdC
LHKJJB_06785 LHKJJB_06785 100.0 Morganella morganii S3 frdC fumarate reductase subunit FrdC
HKOGLL_04145 HKOGLL_04145 100.0 Morganella morganii S5 frdC fumarate reductase subunit FrdC
F4V73_RS11260 F4V73_RS11260 93.1 Morganella psychrotolerans frdC fumarate reductase subunit FrdC
PMI_RS17840 PMI_RS17840 67.7 Proteus mirabilis HI4320 frdC fumarate reductase subunit FrdC

Distribution of the homologs in the orthogroup group_850

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_850

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A1JIQ1 4.21e-65 196 67 0 130 3 frdC Fumarate reductase subunit C Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A9QYP6 1e-64 195 67 0 130 3 frdC Fumarate reductase subunit C Yersinia pestis bv. Antiqua (strain Angola)
B1JMQ4 1.01e-64 195 67 0 130 3 frdC Fumarate reductase subunit C Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FC9 1.01e-64 195 67 0 130 3 frdC Fumarate reductase subunit C Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRQ4 1.01e-64 195 67 0 130 3 frdC Fumarate reductase subunit C Yersinia pestis (strain Pestoides F)
Q1CEE0 1.01e-64 195 67 0 130 3 frdC Fumarate reductase subunit C Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZIX7 1.01e-64 195 67 0 130 3 frdC Fumarate reductase subunit C Yersinia pestis
B2K1Z0 1.01e-64 195 67 0 130 3 frdC Fumarate reductase subunit C Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0Y6 1.01e-64 195 67 0 130 3 frdC Fumarate reductase subunit C Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMZ5 1.01e-64 195 67 0 130 3 frdC Fumarate reductase subunit C Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B7NG91 4.64e-63 191 67 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q3YUI6 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Shigella sonnei (strain Ss046)
Q0SXC4 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Shigella flexneri serotype 5b (strain 8401)
B2TY30 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LLT6 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R3A5 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Escherichia coli (strain UTI89 / UPEC)
B1LQH5 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Escherichia coli (strain SMS-3-5 / SECEC)
B6I261 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Escherichia coli (strain SE11)
P0A8Q0 9.79e-63 190 67 0 129 1 frdC Fumarate reductase subunit C Escherichia coli (strain K12)
B1ITP4 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A8Q1 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0T9N7 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AJ60 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O1:K1 / APEC
A8A7Q1 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O9:H4 (strain HS)
B1XDQ7 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Escherichia coli (strain K12 / DH10B)
C5A1E6 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Escherichia coli (strain K12 / MC4100 / BW2952)
B7M8R7 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O8 (strain IAI1)
B7NTL3 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z2G3 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8Q2 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O157:H7
B7LC13 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Escherichia coli (strain 55989 / EAEC)
B7MKV9 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPX4 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZV25 9.79e-63 190 67 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O139:H28 (strain E24377A / ETEC)
Q31T87 1.14e-62 190 67 0 129 3 frdC Fumarate reductase subunit C Shigella boydii serotype 4 (strain Sb227)
B7MSH4 2.63e-62 189 66 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O81 (strain ED1a)
Q7MZY2 4.16e-62 189 66 0 130 3 frdC Fumarate reductase subunit C Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q328H2 4.25e-62 189 66 0 129 3 frdC Fumarate reductase subunit C Shigella dysenteriae serotype 1 (strain Sd197)
B4EWY5 1.22e-61 187 67 0 130 3 frdC Fumarate reductase subunit C Proteus mirabilis (strain HI4320)
A8G8T5 1.6e-61 187 66 0 130 3 frdC Fumarate reductase subunit C Serratia proteamaculans (strain 568)
Q83P38 1.73e-61 187 65 0 129 3 frdC Fumarate reductase subunit C Shigella flexneri
P20923 3.49e-61 186 66 0 130 3 frdC Fumarate reductase subunit C Proteus vulgaris
B5Y348 5.33e-57 176 66 0 130 3 frdC Fumarate reductase subunit C Klebsiella pneumoniae (strain 342)
P67638 5.88e-57 176 67 0 130 3 frdC Fumarate reductase subunit C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67639 5.88e-57 176 67 0 130 3 frdC Fumarate reductase subunit C Salmonella typhi
B4TSD6 5.88e-57 176 67 0 130 3 frdC Fumarate reductase subunit C Salmonella schwarzengrund (strain CVM19633)
B5BKG5 5.88e-57 176 67 0 130 3 frdC Fumarate reductase subunit C Salmonella paratyphi A (strain AKU_12601)
A9N410 5.88e-57 176 67 0 130 3 frdC Fumarate reductase subunit C Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PL70 5.88e-57 176 67 0 130 3 frdC Fumarate reductase subunit C Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T2Q0 5.88e-57 176 67 0 130 3 frdC Fumarate reductase subunit C Salmonella newport (strain SL254)
B5R9A2 5.88e-57 176 67 0 130 3 frdC Fumarate reductase subunit C Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R016 5.88e-57 176 67 0 130 3 frdC Fumarate reductase subunit C Salmonella enteritidis PT4 (strain P125109)
Q57GN6 5.88e-57 176 67 0 130 3 frdC Fumarate reductase subunit C Salmonella choleraesuis (strain SC-B67)
B5F2L9 5.88e-57 176 67 0 130 3 frdC Fumarate reductase subunit C Salmonella agona (strain SL483)
B5FRL1 6.63e-57 176 67 0 130 3 frdC Fumarate reductase subunit C Salmonella dublin (strain CT_02021853)
A6TH71 8.53e-57 175 66 0 130 3 frdC Fumarate reductase subunit C Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B4TF89 2.91e-56 174 66 0 130 3 frdC Fumarate reductase subunit C Salmonella heidelberg (strain SL476)
A4W5P9 4.75e-54 168 66 0 130 3 frdC Fumarate reductase subunit C Enterobacter sp. (strain 638)
A8AMP4 2.92e-49 156 66 0 129 3 frdC Fumarate reductase subunit C Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q9CP58 8.77e-40 132 48 1 124 3 frdC Fumarate reductase subunit C Pasteurella multocida (strain Pm70)
P44892 4.15e-38 128 48 3 127 3 frdC Fumarate reductase subunit C Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P59841 3.18e-35 120 46 1 117 3 frdC Fumarate reductase subunit C Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q6LM13 3.85e-33 115 43 0 123 3 frdC Fumarate reductase subunit C Photobacterium profundum (strain SS9)
Q87KY2 6.06e-30 107 40 0 125 3 frdC Fumarate reductase subunit C Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VHR5 5.71e-29 105 40 0 125 3 frdC Fumarate reductase subunit C Vibrio atlanticus (strain LGP32)
A7MZ43 1.81e-28 103 38 0 125 3 frdC Fumarate reductase subunit C Vibrio campbellii (strain ATCC BAA-1116)
B5FBS7 5.1e-28 102 37 0 125 3 frdC Fumarate reductase subunit C Aliivibrio fischeri (strain MJ11)
Q5E2B5 5.1e-28 102 37 0 125 3 frdC Fumarate reductase subunit C Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EMS0 6.7e-28 102 37 0 125 3 frdC Fumarate reductase subunit C Aliivibrio salmonicida (strain LFI1238)
Q7MGX5 2.45e-27 100 39 0 125 3 frdC Fumarate reductase subunit C Vibrio vulnificus (strain YJ016)
Q8DCX3 2.45e-27 100 39 0 125 3 frdC Fumarate reductase subunit C Vibrio vulnificus (strain CMCP6)
C3LS87 2.16e-26 98 37 0 125 3 frdC Fumarate reductase subunit C Vibrio cholerae serotype O1 (strain M66-2)
Q9KNS3 2.16e-26 98 37 0 125 3 frdC Fumarate reductase subunit C Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4Z1 2.16e-26 98 37 0 125 3 frdC Fumarate reductase subunit C Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P9WNB7 8.91e-07 48 29 1 124 3 frdC Fumarate reductase subunit C Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A5U2R1 8.91e-07 48 29 1 124 3 frdC Fumarate reductase subunit C Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P9WNB6 4.95e-06 45 29 1 124 3 frdC Fumarate reductase subunit C Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_03610
Feature type CDS
Gene frdC
Product fumarate reductase subunit FrdC
Location 128241 - 128633 (strand: 1)
Length 393 (nucleotides) / 130 (amino acids)
In genomic island -

Contig

Accession contig_3
Length 210665 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_850
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02300 Fumarate reductase subunit C

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3029 Energy production and conversion (C) C Fumarate reductase subunit C

Kegg Ortholog Annotation(s)

Protein Sequence

MTTKRKPYVREMTPTWWNKLGFYRFYMLREGTAVVQLWFSLLVMYGVYCLKGGPADWAGYVHFLQNPVVVLVNILTLAGTLLHTVTWFQLAPKAVNIVIKDEKMGPEPIVRLLWVVTLIVNAVILAVALL

Flanking regions ( +/- flanking 50bp)

GCGGAAGATTACATTATTGCCCGTCTGAAACCACAATAAGGAAGAGAGAAATGACGACCAAACGTAAGCCTTATGTGCGTGAAATGACACCGACATGGTGGAATAAACTCGGTTTTTACCGTTTTTACATGCTGCGGGAAGGTACCGCAGTGGTCCAGCTCTGGTTCAGCCTGCTGGTTATGTACGGCGTTTACTGTCTTAAGGGCGGCCCGGCGGACTGGGCAGGGTATGTCCACTTCCTGCAGAATCCGGTGGTGGTACTGGTTAATATCCTGACTCTGGCCGGTACCCTGCTGCACACGGTGACCTGGTTCCAGCTGGCACCGAAAGCCGTCAATATTGTTATCAAAGACGAAAAAATGGGACCGGAGCCGATTGTCCGTCTGCTCTGGGTGGTGACCCTCATTGTTAACGCCGTCATTCTGGCCGTTGCGTTACTGTGATAAGGAAGGAAACTGATATGATTAATCCGAATCCGAAACGCTCACAGGAA