Homologs in group_850

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03610 FBDBKF_03610 67.7 Morganella morganii S1 frdC fumarate reductase subunit FrdC
EHELCC_06925 EHELCC_06925 67.7 Morganella morganii S2 frdC fumarate reductase subunit FrdC
NLDBIP_07250 NLDBIP_07250 67.7 Morganella morganii S4 frdC fumarate reductase subunit FrdC
LHKJJB_06785 LHKJJB_06785 67.7 Morganella morganii S3 frdC fumarate reductase subunit FrdC
HKOGLL_04145 HKOGLL_04145 67.7 Morganella morganii S5 frdC fumarate reductase subunit FrdC
F4V73_RS11260 F4V73_RS11260 66.2 Morganella psychrotolerans frdC fumarate reductase subunit FrdC

Distribution of the homologs in the orthogroup group_850

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_850

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EWY5 6.48e-91 261 100 0 131 3 frdC Fumarate reductase subunit C Proteus mirabilis (strain HI4320)
P20923 2.03e-90 260 99 0 131 3 frdC Fumarate reductase subunit C Proteus vulgaris
A1JIQ1 6.87e-63 191 66 0 130 3 frdC Fumarate reductase subunit C Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B7MSH4 4.42e-61 186 65 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O81 (strain ED1a)
B7NG91 1.09e-60 185 65 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q3YUI6 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Shigella sonnei (strain Ss046)
Q0SXC4 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Shigella flexneri serotype 5b (strain 8401)
B2TY30 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LLT6 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R3A5 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Escherichia coli (strain UTI89 / UPEC)
B1LQH5 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Escherichia coli (strain SMS-3-5 / SECEC)
B6I261 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Escherichia coli (strain SE11)
P0A8Q0 3.29e-60 184 64 0 129 1 frdC Fumarate reductase subunit C Escherichia coli (strain K12)
B1ITP4 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A8Q1 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0T9N7 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AJ60 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O1:K1 / APEC
A8A7Q1 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O9:H4 (strain HS)
B1XDQ7 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Escherichia coli (strain K12 / DH10B)
C5A1E6 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Escherichia coli (strain K12 / MC4100 / BW2952)
B7M8R7 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O8 (strain IAI1)
B7NTL3 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z2G3 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8Q2 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O157:H7
B7LC13 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Escherichia coli (strain 55989 / EAEC)
B7MKV9 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPX4 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZV25 3.29e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Escherichia coli O139:H28 (strain E24377A / ETEC)
A8G8T5 3.88e-60 184 66 0 130 3 frdC Fumarate reductase subunit C Serratia proteamaculans (strain 568)
Q328H2 4.37e-60 184 64 0 129 3 frdC Fumarate reductase subunit C Shigella dysenteriae serotype 1 (strain Sd197)
Q31T87 9.31e-60 183 63 0 129 3 frdC Fumarate reductase subunit C Shigella boydii serotype 4 (strain Sb227)
Q83P38 1.21e-59 182 63 0 129 3 frdC Fumarate reductase subunit C Shigella flexneri
B1JMQ4 5.44e-59 181 61 0 130 3 frdC Fumarate reductase subunit C Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FC9 5.44e-59 181 61 0 130 3 frdC Fumarate reductase subunit C Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRQ4 5.44e-59 181 61 0 130 3 frdC Fumarate reductase subunit C Yersinia pestis (strain Pestoides F)
Q1CEE0 5.44e-59 181 61 0 130 3 frdC Fumarate reductase subunit C Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZIX7 5.44e-59 181 61 0 130 3 frdC Fumarate reductase subunit C Yersinia pestis
B2K1Z0 5.44e-59 181 61 0 130 3 frdC Fumarate reductase subunit C Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0Y6 5.44e-59 181 61 0 130 3 frdC Fumarate reductase subunit C Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMZ5 5.44e-59 181 61 0 130 3 frdC Fumarate reductase subunit C Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A9QYP6 1.46e-58 180 60 0 130 3 frdC Fumarate reductase subunit C Yersinia pestis bv. Antiqua (strain Angola)
Q7MZY2 1.36e-56 175 57 0 130 3 frdC Fumarate reductase subunit C Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P67638 5.17e-55 171 65 0 129 3 frdC Fumarate reductase subunit C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67639 5.17e-55 171 65 0 129 3 frdC Fumarate reductase subunit C Salmonella typhi
B4TSD6 5.17e-55 171 65 0 129 3 frdC Fumarate reductase subunit C Salmonella schwarzengrund (strain CVM19633)
B5BKG5 5.17e-55 171 65 0 129 3 frdC Fumarate reductase subunit C Salmonella paratyphi A (strain AKU_12601)
A9N410 5.17e-55 171 65 0 129 3 frdC Fumarate reductase subunit C Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PL70 5.17e-55 171 65 0 129 3 frdC Fumarate reductase subunit C Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T2Q0 5.17e-55 171 65 0 129 3 frdC Fumarate reductase subunit C Salmonella newport (strain SL254)
B5R9A2 5.17e-55 171 65 0 129 3 frdC Fumarate reductase subunit C Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R016 5.17e-55 171 65 0 129 3 frdC Fumarate reductase subunit C Salmonella enteritidis PT4 (strain P125109)
Q57GN6 5.17e-55 171 65 0 129 3 frdC Fumarate reductase subunit C Salmonella choleraesuis (strain SC-B67)
B5F2L9 5.17e-55 171 65 0 129 3 frdC Fumarate reductase subunit C Salmonella agona (strain SL483)
B5FRL1 7.26e-55 171 65 0 129 3 frdC Fumarate reductase subunit C Salmonella dublin (strain CT_02021853)
B4TF89 3.19e-54 169 65 0 129 3 frdC Fumarate reductase subunit C Salmonella heidelberg (strain SL476)
B5Y348 1.17e-53 167 62 0 129 3 frdC Fumarate reductase subunit C Klebsiella pneumoniae (strain 342)
A6TH71 3.14e-53 166 61 0 129 3 frdC Fumarate reductase subunit C Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A4W5P9 6.68e-52 163 62 0 129 3 frdC Fumarate reductase subunit C Enterobacter sp. (strain 638)
A8AMP4 1.91e-48 154 64 0 129 3 frdC Fumarate reductase subunit C Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q9CP58 2.69e-38 129 47 1 124 3 frdC Fumarate reductase subunit C Pasteurella multocida (strain Pm70)
P44892 1.26e-36 124 45 1 131 3 frdC Fumarate reductase subunit C Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P59841 3.41e-35 120 46 1 117 3 frdC Fumarate reductase subunit C Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q6LM13 3.95e-33 115 41 0 123 3 frdC Fumarate reductase subunit C Photobacterium profundum (strain SS9)
B7VHR5 1.56e-30 108 40 0 125 3 frdC Fumarate reductase subunit C Vibrio atlanticus (strain LGP32)
Q87KY2 2.54e-30 108 40 0 125 3 frdC Fumarate reductase subunit C Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MZ43 8.33e-30 107 39 0 125 3 frdC Fumarate reductase subunit C Vibrio campbellii (strain ATCC BAA-1116)
B5FBS7 7.36e-29 104 37 0 125 3 frdC Fumarate reductase subunit C Aliivibrio fischeri (strain MJ11)
Q5E2B5 7.36e-29 104 37 0 125 3 frdC Fumarate reductase subunit C Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EMS0 7.95e-29 104 37 0 125 3 frdC Fumarate reductase subunit C Aliivibrio salmonicida (strain LFI1238)
C3LS87 9.11e-28 102 37 0 125 3 frdC Fumarate reductase subunit C Vibrio cholerae serotype O1 (strain M66-2)
Q9KNS3 9.11e-28 102 37 0 125 3 frdC Fumarate reductase subunit C Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4Z1 9.11e-28 102 37 0 125 3 frdC Fumarate reductase subunit C Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7MGX5 1.42e-27 101 36 0 125 3 frdC Fumarate reductase subunit C Vibrio vulnificus (strain YJ016)
Q8DCX3 1.42e-27 101 36 0 125 3 frdC Fumarate reductase subunit C Vibrio vulnificus (strain CMCP6)
P9WNB7 9.52e-10 55 29 1 124 3 frdC Fumarate reductase subunit C Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A5U2R1 9.52e-10 55 29 1 124 3 frdC Fumarate reductase subunit C Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P9WNB6 1.69e-09 55 29 1 124 3 frdC Fumarate reductase subunit C Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17840
Feature type CDS
Gene frdC
Product fumarate reductase subunit FrdC
Location 3917374 - 3917769 (strand: -1)
Length 396 (nucleotides) / 131 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_850
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02300 Fumarate reductase subunit C

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3029 Energy production and conversion (C) C Fumarate reductase subunit C

Kegg Ortholog Annotation(s)

Protein Sequence

MTTKRKPYVRGMQPNWWTKLGFYRFYITREGTCLPQLWFSLVVLFGVFALKNGPESWAGFVGFLSNPIVMLINIVTLIATVFHTATWFKLAPKAVNIVVKDEKLPQEPIVRGLWGLTIVVTVVILAVALIV

Flanking regions ( +/- flanking 50bp)

CAAGACTTTGTCATTGCCATGCTGAAACCACGTTAAGGAGGAAACAAGACATGACAACAAAACGTAAGCCTTATGTTCGTGGTATGCAGCCAAACTGGTGGACGAAACTCGGTTTCTATCGTTTCTACATCACCCGTGAAGGAACTTGTCTACCACAACTTTGGTTCAGTCTGGTTGTACTGTTCGGTGTATTTGCACTGAAAAATGGACCAGAAAGTTGGGCGGGATTCGTTGGATTCCTAAGTAACCCAATAGTGATGCTGATTAATATTGTGACCCTTATCGCAACGGTATTCCATACGGCCACTTGGTTTAAGCTTGCACCGAAAGCCGTTAATATCGTCGTTAAAGATGAAAAATTACCACAAGAGCCTATCGTTCGTGGTTTATGGGGTCTAACCATCGTCGTGACTGTCGTTATTCTGGCAGTGGCGCTAATTGTTTAACCCAGGAGGAAATAATGAATCAGAATCAACTTCCTAAGCGCTCTGATGAA