Homologs in group_347

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12150 FBDBKF_12150 96.4 Morganella morganii S1 oxyR DNA-binding transcriptional regulator OxyR
EHELCC_14155 EHELCC_14155 96.4 Morganella morganii S2 oxyR DNA-binding transcriptional regulator OxyR
NLDBIP_15250 NLDBIP_15250 96.4 Morganella morganii S4 oxyR DNA-binding transcriptional regulator OxyR
LHKJJB_15360 LHKJJB_15360 96.4 Morganella morganii S3 oxyR DNA-binding transcriptional regulator OxyR
HKOGLL_14480 HKOGLL_14480 96.4 Morganella morganii S5 oxyR DNA-binding transcriptional regulator OxyR
PMI_RS11770 PMI_RS11770 29.2 Proteus mirabilis HI4320 - LysR family transcriptional regulator
PMI_RS16025 PMI_RS16025 80.5 Proteus mirabilis HI4320 oxyR DNA-binding transcriptional regulator OxyR

Distribution of the homologs in the orthogroup group_347

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_347

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACQ4 0.0 507 81 0 299 1 oxyR DNA-binding transcriptional dual regulator OxyR Escherichia coli (strain K12)
P0ACQ5 0.0 507 81 0 299 3 oxyR Hydrogen peroxide-inducible genes activator Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACQ6 0.0 507 81 0 299 3 oxyR Hydrogen peroxide-inducible genes activator Escherichia coli O157:H7
P71318 2.84e-180 502 80 0 298 3 oxyR Hydrogen peroxide-inducible genes activator Pectobacterium carotovorum subsp. carotovorum
Q9X725 2.3e-179 499 81 0 293 3 oxyR Hydrogen peroxide-inducible genes activator Dickeya chrysanthemi
P44418 1.74e-149 424 68 0 289 3 oxyR Hydrogen peroxide-inducible genes activator Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P52667 3.95e-51 173 35 3 292 3 estR HTH-type transcriptional regulator EstR Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q9X5P2 1.58e-50 172 39 2 276 2 oxyR Probable hydrogen peroxide-inducible genes activator Streptomyces viridosporus
P52677 4.21e-48 166 35 1 298 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium avium
O87324 4.59e-48 166 37 2 295 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium marinum
P52678 7.99e-48 165 36 1 289 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium leprae (strain TN)
P37499 2.75e-34 129 27 2 299 3 yybE Uncharacterized HTH-type transcriptional regulator YybE Bacillus subtilis (strain 168)
P27111 1.08e-30 120 30 2 273 1 cynR HTH-type transcriptional regulator CynR Escherichia coli (strain K12)
O87883 2.06e-30 116 37 0 180 3 oxyR Probable hydrogen peroxide-inducible genes activator (Fragment) Mycobacterium xenopi
P94387 2.74e-30 119 28 8 308 3 ycgK Uncharacterized HTH-type transcriptional regulator YcgK Bacillus subtilis (strain 168)
P20668 2.94e-29 116 28 1 243 1 gltC Transcriptional dual regulator GltC Bacillus subtilis (strain 168)
Q8X4M5 6.55e-29 115 30 2 276 3 cynR HTH-type transcriptional regulator CynR Escherichia coli O157:H7
Q04778 7.75e-28 112 30 1 246 3 alsR HTH-type transcriptional regulator AlsR Bacillus subtilis (strain 168)
P52696 6.34e-27 110 30 2 246 3 ybhD Uncharacterized HTH-type transcriptional regulator YbhD Escherichia coli (strain K12)
P39592 6.79e-27 110 26 0 242 3 ywbI Uncharacterized HTH-type transcriptional regulator YwbI Bacillus subtilis (strain 168)
O32255 6.26e-26 107 27 4 254 3 yvbU Uncharacterized HTH-type transcriptional regulator YvbU Bacillus subtilis (strain 168)
P25544 1.28e-25 106 28 5 280 3 rbcR RuBisCO operon transcriptional regulator Allochromatium vinosum
P20667 1.3e-24 103 30 10 286 3 catR HTH-type transcriptional regulator CatR Pseudomonas putida
P0ACR8 2.55e-24 103 27 2 290 3 yfeR Uncharacterized HTH-type transcriptional regulator YfeR Shigella flexneri
P0ACR7 2.55e-24 103 27 2 290 3 yfeR Uncharacterized HTH-type transcriptional regulator YfeR Escherichia coli (strain K12)
Q08597 6.53e-24 102 30 5 247 3 nac Nitrogen assimilation regulatory protein nac Klebsiella aerogenes
P52595 1.03e-23 101 31 5 240 3 cbbR HTH-type transcriptional regulator CbbR Rhodospirillum rubrum
P77559 1.11e-23 101 31 4 247 3 ynfL Uncharacterized HTH-type transcriptional regulator YnfL Escherichia coli (strain K12)
O68014 1.24e-23 101 29 8 309 1 benM HTH-type transcriptional regulator BenM Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P0A9F3 1.95e-23 101 26 4 253 3 cysB HTH-type transcriptional regulator CysB Escherichia coli (strain K12)
P0A9F4 1.95e-23 101 26 4 253 3 cysB HTH-type transcriptional regulator CysB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9F5 1.95e-23 101 26 4 253 3 cysB HTH-type transcriptional regulator CysB Escherichia coli O157:H7
P96725 4.35e-23 99 28 6 252 3 ywqM Uncharacterized HTH-type transcriptional regulator YwqM Bacillus subtilis (strain 168)
P70785 9.51e-23 99 30 4 255 3 ttuA HTH-type transcriptional regulator TtuA Agrobacterium vitis
P42722 1.24e-22 99 30 4 244 3 cfxR HTH-type transcriptional regulator CfxR Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P06614 1.37e-22 99 26 3 250 1 cysB HTH-type transcriptional regulator CysB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q47141 2.47e-22 97 29 3 246 1 hcaR Hca operon transcriptional activator HcaR Escherichia coli (strain K12)
P45600 2.75e-22 97 25 3 250 1 cysB HTH-type transcriptional regulator CysB Klebsiella pneumoniae
O33945 1.93e-20 92 26 6 299 3 None Probable cat1 operon transcriptional activator Acinetobacter lwoffii
Q47005 2.05e-20 92 29 5 248 3 nac Nitrogen assimilation regulatory protein nac Escherichia coli (strain K12)
Q44311 2.05e-20 92 25 8 295 3 soxR HTH-type transcriptional regulator SoxR Arthrobacter sp. (strain TE1826)
Q3MCB5 1.22e-19 90 25 9 308 3 rbcR Probable RuBisCO transcriptional regulator Trichormus variabilis (strain ATCC 29413 / PCC 7937)
P73123 1.99e-19 90 26 7 291 3 rbcR Probable RuBisCO transcriptional regulator Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q55459 2.84e-19 89 25 3 239 1 cmpR HTH-type transcriptional activator CmpR Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P45105 1.09e-18 87 26 5 248 3 cysB HTH-type transcriptional regulator CysB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8YQ82 1.21e-18 88 25 9 308 3 rbcR Probable RuBisCO transcriptional regulator Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P94501 1.24e-18 87 25 4 276 1 gltR HTH-type transcriptional regulator GltR Bacillus subtilis (strain 168)
B4E8V9 1.35e-18 87 26 3 254 1 cysB HTH-type transcriptional regulator CysB Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
P52669 1.43e-18 87 29 3 245 3 ttuA HTH-type transcriptional regulator TtuA Agrobacterium vitis
Q06610 1.52e-18 87 26 3 291 3 rbcR RuBisCO operon transcriptional regulator Acidithiobacillus ferrooxidans
P0A2Q2 1.84e-18 87 28 3 270 3 ilvY HTH-type transcriptional activator IlvY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q3 1.84e-18 87 28 3 270 3 ilvY HTH-type transcriptional activator IlvY Salmonella typhi
P05827 2.43e-18 86 28 3 270 3 ilvY HTH-type transcriptional regulator IlvY Escherichia coli (strain K12)
P94403 2.44e-18 86 26 6 258 3 bsdA HTH-type transcriptional regulator BsdA Bacillus subtilis (strain 168)
O06703 7.8e-18 85 26 0 235 3 bbuR HTH-type transcriptional regulator BbuR Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q6B936 1.03e-17 85 26 6 258 3 rbcR Probable RuBisCO transcriptional regulator Gracilaria tenuistipitata var. liui
A2CI69 1.16e-17 85 24 8 308 3 rbcR Probable RuBisCO transcriptional regulator Chlorokybus atmophyticus
O19892 1.78e-17 84 25 5 260 3 rbcR Probable RuBisCO transcriptional regulator Cyanidium caldarium
Q5N5I5 1.98e-17 84 22 3 241 3 cmpR HTH-type transcriptional activator CmpR Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q9F1R2 1.98e-17 84 22 3 241 1 cmpR HTH-type transcriptional activator CmpR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
O78432 2.41e-17 84 23 5 258 3 rbcR Probable RuBisCO transcriptional regulator Guillardia theta
P39647 3.8e-17 83 24 2 239 1 cysL HTH-type transcriptional regulator CysL Bacillus subtilis (strain 168)
P71025 4.49e-17 82 25 5 248 3 czcR HTH-type transcriptional regulator CzcR Bacillus subtilis (strain 168)
A0T0V5 2.43e-16 81 23 7 293 3 rbcR-A Probable RuBisCO transcriptional regulator Thalassiosira pseudonana
P52670 3.33e-16 80 26 5 278 3 ilvR HTH-type transcriptional regulator IlvR Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P07774 4.02e-16 80 28 5 250 1 catM HTH-type transcriptional regulator CatM Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P23841 4.81e-16 80 26 2 243 3 xapR HTH-type transcriptional regulator XapR Escherichia coli (strain K12)
Q85G62 5.14e-16 80 26 4 253 3 rbcR Probable RuBisCO transcriptional regulator Cyanidioschyzon merolae (strain NIES-3377 / 10D)
O35038 6.35e-16 80 25 1 193 3 ytlI HTH-type transcriptional regulator YtlI Bacillus subtilis (strain 168)
B4E8S9 8.94e-16 79 24 5 293 1 ssuR HTH-type transcriptional regulator SsuR Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q4G384 2.03e-15 78 25 6 259 3 rbcR Probable RuBisCO transcriptional regulator Emiliania huxleyi
P52666 2.1e-15 78 27 4 249 3 budR HTH-type transcriptional regulator BudR Raoultella terrigena
Q81VJ1 3.03e-15 77 24 9 296 3 czcR HTH-type transcriptional regulator CzcR Bacillus anthracis
P52693 3.81e-15 77 23 5 308 3 ntcB Probable nitrogen assimilation transcriptional activator Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P49518 5.1e-15 77 23 8 290 3 rbcR Probable RuBisCO transcriptional regulator Trieres chinensis
Q63H01 7.74e-15 76 24 9 296 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ZK / E33L)
Q73EY2 7.74e-15 76 24 9 296 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ATCC 10987 / NRS 248)
A4QH19 8.2e-15 76 28 4 221 1 shiR HTH-type transcriptional regulator ShiR Corynebacterium glutamicum (strain R)
Q47083 9.3e-15 76 26 3 243 1 cbl HTH-type transcriptional regulator cbl Escherichia coli (strain K12)
Q81IX0 1.11e-14 76 24 9 296 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6HPH4 1.2e-14 76 24 9 296 3 czcR HTH-type transcriptional regulator CzcR Bacillus thuringiensis subsp. konkukian (strain 97-27)
A0R8S0 1.26e-14 76 24 9 296 3 czcR HTH-type transcriptional regulator CzcR Bacillus thuringiensis (strain Al Hakam)
P52686 2.59e-14 75 29 2 199 3 sdsB SDS degradation transcriptional activation protein Pseudomonas sp. (strain ATCC 19151)
A7Z5E4 2.61e-14 75 24 6 296 3 yofA HTH-type transcriptional regulator YofA Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A0T0G2 3.53e-14 75 22 7 263 3 rbcR Probable RuBisCO transcriptional regulator Phaeodactylum tricornutum (strain CCAP 1055/1)
P0A4T7 3.77e-14 75 27 1 176 3 pcaQ HTH-type transcriptional regulator PcaQ Rhizobium radiobacter
P0A4T6 3.77e-14 75 27 1 176 3 pcaQ HTH-type transcriptional regulator PcaQ Agrobacterium fabrum (strain C58 / ATCC 33970)
Q05840 7.2e-14 73 24 3 246 3 clcR HTH-type transcriptional regulator ClcR Pseudomonas putida
P0A9G1 9.91e-14 73 27 3 247 3 metR HTH-type transcriptional regulator MetR Shigella flexneri
P0A9F9 9.91e-14 73 27 3 247 1 metR HTH-type transcriptional regulator MetR Escherichia coli (strain K12)
P0A9G0 9.91e-14 73 27 3 247 3 metR HTH-type transcriptional regulator MetR Escherichia coli O157:H7
P42427 1.41e-13 72 28 1 178 3 tfdT HTH-type transcriptional regulator TfdT Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P56885 1.7e-13 73 23 2 274 3 cbbR HTH-type transcriptional regulator CbbR Sinorhizobium medicae (strain WSM419)
P52662 2.01e-13 72 26 2 234 3 pecT HTH-type transcriptional regulator PecT Dickeya dadantii (strain 3937)
P55181 2.12e-13 72 26 0 145 3 yxjO Uncharacterized HTH-type transcriptional regulator YxjO Bacillus subtilis (strain 168)
O34685 2.85e-13 72 21 3 292 1 yofA HTH-type transcriptional regulator YofA Bacillus subtilis (strain 168)
Q8VWE6 3.43e-13 72 26 6 294 3 lrhA Probable HTH-type transcriptional regulator LrhA Escherichia coli O157:H7
P36771 4.23e-13 72 26 6 294 1 lrhA Probable HTH-type transcriptional regulator LrhA Escherichia coli (strain K12)
P52665 5e-13 68 33 2 145 3 budR HTH-type transcriptional regulator BudR (Fragment) Klebsiella aerogenes
P58332 1.08e-12 70 23 2 274 3 cbbR HTH-type transcriptional regulator CbbR Rhizobium meliloti (strain 1021)
P77744 1.26e-12 70 28 0 145 3 abgR HTH-type transcriptional regulator AbgR Escherichia coli (strain K12)
P30864 2.62e-12 69 27 5 254 3 yafC Uncharacterized HTH-type transcriptional regulator YafC Escherichia coli (strain K12)
P44821 2.65e-12 69 27 0 148 3 ilvY HTH-type transcriptional activator IlvY Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9JXW7 5.33e-12 68 25 3 250 1 crgA HTH-type transcriptional regulator CrgA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JPU9 6.51e-12 68 25 3 250 1 crgA HTH-type transcriptional regulator CrgA Neisseria meningitidis serogroup C (strain 8013)
P37641 7.65e-12 68 29 2 164 3 yhjC Uncharacterized HTH-type transcriptional regulator YhjC Escherichia coli (strain K12)
P39127 7.86e-12 68 23 6 251 3 citR HTH-type transcriptional regulator CitR Bacillus subtilis (strain 168)
O07906 9e-12 67 25 2 179 3 yraN Uncharacterized HTH-type transcriptional regulator YraN Bacillus subtilis (strain 168)
P74422 1.42e-11 67 22 3 266 3 ntcB Probable nitrogen assimilation transcriptional activator Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O32186 2.06e-11 67 25 6 261 3 yusT Uncharacterized HTH-type transcriptional regulator YusT Bacillus subtilis (strain 168)
P0A2Q4 3.77e-11 66 26 3 247 3 metR HTH-type transcriptional regulator MetR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q5 3.77e-11 66 26 3 247 3 metR HTH-type transcriptional regulator MetR Salmonella typhi
P52661 4.38e-11 66 30 1 176 1 gbpR HTH-type transcriptional regulator GbpR Azospirillum brasilense
P0ACQ9 5.26e-11 65 23 5 230 3 tdcA HTH-type transcriptional regulator TdcA Shigella flexneri
P0ACQ7 5.26e-11 65 23 5 230 3 tdcA HTH-type transcriptional regulator TdcA Escherichia coli (strain K12)
P0ACQ8 5.26e-11 65 23 5 230 3 tdcA HTH-type transcriptional regulator TdcA Escherichia coli O157:H7
P77309 5.44e-11 65 22 5 292 3 yneJ Uncharacterized HTH-type transcriptional regulator YneJ Escherichia coli (strain K12)
O33812 1.09e-10 64 25 2 145 3 None Uncharacterized HTH-type transcriptional regulator in lacR 5'region (Fragment) Staphylococcus xylosus
Q46M57 1.38e-10 64 26 3 218 1 tfdR HTH-type transcriptional regulator TdfR Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P0A4T3 1.38e-10 64 28 3 200 1 occR Octopine catabolism/uptake operon regulatory protein OccR Rhizobium radiobacter
P0A4T4 1.38e-10 64 28 3 200 1 occR Octopine catabolism/uptake operon regulatory protein OccR Agrobacterium tumefaciens (strain Ach5)
O34701 1.42e-10 64 24 8 256 3 yoaU Uncharacterized HTH-type transcriptional regulator YoaU Bacillus subtilis (strain 168)
Q46M54 1.54e-10 64 26 3 216 1 tfdS HTH-type transcriptional regulator TfdS Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P16400 3.63e-10 63 23 8 298 3 mleR Malolactic fermentation system transcriptional activator Lactococcus lactis subsp. lactis (strain IL1403)
Q9HWH8 4.36e-10 62 24 2 180 3 nmoR HTH-type transcriptional regulator NmoR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8KA72 4.45e-10 63 23 5 297 3 metR HTH-type transcriptional regulator MetR Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P0ACR4 1.99e-09 60 21 2 240 1 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli (strain K12)
P0ACR5 1.99e-09 60 21 2 240 3 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACR6 1.99e-09 60 21 2 240 3 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli O157:H7
P77171 2.09e-09 60 26 3 178 3 ydcI Uncharacterized HTH-type transcriptional regulator YdcI Escherichia coli (strain K12)
P0DV33 3.01e-09 60 24 1 175 1 admX HTH-type transcriptional regulator AdmX Serratia plymuthica
P52690 3.41e-09 60 23 5 247 3 cbbR HTH-type transcriptional regulator CbbR Cereibacter sphaeroides
P43161 4.29e-09 60 28 4 200 3 mprR Small neutral protease regulatory protein Streptomyces lividans
Q88JX7 5.2e-09 60 28 3 174 3 galR HTH-type transcriptional regulator GalR Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9L127 5.45e-09 60 28 4 200 3 mprR Small neutral protease regulatory protein Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P0A9F6 7.73e-09 59 28 1 126 1 gcvA Glycine cleavage system transcriptional activator Escherichia coli (strain K12)
P0A9F7 7.73e-09 59 28 1 126 3 gcvA Glycine cleavage system transcriptional activator Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9F8 7.73e-09 59 28 1 126 3 gcvA Glycine cleavage system transcriptional activator Escherichia coli O157:H7
Q00678 8.09e-09 59 21 0 237 3 nocR Regulatory protein NocR Agrobacterium fabrum (strain C58 / ATCC 33970)
P94678 1.04e-08 58 31 4 179 1 tsaR HTH-type transcriptional regulator TsaR Comamonas testosteroni
P52691 1.22e-08 58 26 4 253 3 lrrA Probable HTH-type transcriptional regulator LrrA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P72294 1.44e-08 58 25 3 198 3 occR Octopine catabolism/uptake operon regulatory protein OccR Rhizobium meliloti
P43160 1.95e-08 58 25 2 198 3 mprR Small neutral protease regulatory protein Streptomyces coelicolor
A0A0H2ZDG9 2.03e-08 58 27 5 167 3 PA14_22550 HTH-type transcriptional repressor PA14_22550 Pseudomonas aeruginosa (strain UCBPP-PA14)
P52684 2.38e-08 57 24 8 286 3 mauR Malonate utilization transcriptional regulator Klebsiella pneumoniae
P35112 3.07e-08 57 21 0 220 3 nocR Regulatory protein NocR Agrobacterium tumefaciens (strain T37)
P16931 4.11e-08 57 29 1 147 3 dgdR HTH-type transcriptional regulator DgdR Burkholderia cepacia
B4SYF7 4.21e-08 57 26 6 244 3 hdfR HTH-type transcriptional regulator HdfR Salmonella newport (strain SL254)
P0A2Q0 4.53e-08 57 26 6 244 3 hdfR HTH-type transcriptional regulator HdfR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q1 4.53e-08 57 26 6 244 3 hdfR HTH-type transcriptional regulator HdfR Salmonella typhi
B5BIR0 4.53e-08 57 26 6 244 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi A (strain AKU_12601)
C0Q2U0 4.53e-08 57 26 6 244 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi C (strain RKS4594)
A9MXD5 4.53e-08 57 26 6 244 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJZ0 4.53e-08 57 26 6 244 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TAZ8 4.53e-08 57 26 6 244 3 hdfR HTH-type transcriptional regulator HdfR Salmonella heidelberg (strain SL476)
B5EZ22 4.53e-08 57 26 6 244 3 hdfR HTH-type transcriptional regulator HdfR Salmonella agona (strain SL483)
B4TNR5 5.46e-08 56 26 6 244 3 hdfR HTH-type transcriptional regulator HdfR Salmonella schwarzengrund (strain CVM19633)
P45349 6.97e-08 56 26 2 190 3 metR HTH-type transcriptional regulator MetR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44876 1.07e-07 55 20 6 298 3 HI_0775 Uncharacterized HTH-type transcriptional regulator HI_0775 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P25547 1.19e-07 55 25 5 204 3 gbpR HTH-type transcriptional regulator GbpR Rhizobium radiobacter
O34827 1.19e-07 55 25 2 147 3 ykuM Uncharacterized HTH-type transcriptional regulator YkuM Bacillus subtilis (strain 168)
B5FN59 1.51e-07 55 25 6 244 3 hdfR HTH-type transcriptional regulator HdfR Salmonella dublin (strain CT_02021853)
Q57748 1.58e-07 55 22 6 257 3 MJ0300 Uncharacterized HTH-type transcriptional regulator MJ0300 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P39376 1.9e-07 55 25 9 270 1 yjiE HTH-type transcriptional regulator YjiE Escherichia coli (strain K12)
Q765S2 2.56e-07 54 43 0 67 3 allS HTH-type transcriptional activator AllS Klebsiella pneumoniae
P03030 3.29e-07 54 22 7 293 3 lysR Transcriptional activator protein LysR Escherichia coli (strain K12)
Q1R4H3 5.55e-07 53 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain UTI89 / UPEC)
P59369 5.55e-07 53 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAV4 5.55e-07 53 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7N260 5.55e-07 53 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O81 (strain ED1a)
B7MGH6 5.55e-07 53 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O45:K1 (strain S88 / ExPEC)
P67662 6.72e-07 53 27 0 122 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli (strain K12)
P67663 6.72e-07 53 27 0 122 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P67664 6.72e-07 53 27 0 122 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli O157:H7
B7NF72 7.6e-07 53 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P72131 7.73e-07 53 33 4 147 1 ptxR HTH-type transcriptional regulator PtxR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q08598 1.01e-06 53 24 3 245 3 cbl HTH-type transcriptional regulator cbl Klebsiella aerogenes
B7NU32 1.21e-06 52 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
O69055 1.55e-06 51 28 3 194 3 ptxE Putative HTH-type transcriptional regulator protein PtxE (Fragment) Stutzerimonas stutzeri
Q3YVK2 2e-06 52 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Shigella sonnei (strain Ss046)
P0A8S0 2e-06 52 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Shigella flexneri
Q0SYV7 2e-06 52 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Shigella flexneri serotype 5b (strain 8401)
Q329U3 2e-06 52 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Shigella dysenteriae serotype 1 (strain Sd197)
Q31UM0 2e-06 52 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Shigella boydii serotype 4 (strain Sb227)
B1LLU0 2e-06 52 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain SMS-3-5 / SECEC)
B6I4A0 2e-06 52 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain SE11)
P0A8R9 2e-06 52 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12)
B1IWY2 2e-06 52 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A6M0 2e-06 52 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O9:H4 (strain HS)
B1X9Y2 2e-06 52 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12 / DH10B)
C4ZZ35 2e-06 52 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12 / MC4100 / BW2952)
B7M5B2 2e-06 52 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O8 (strain IAI1)
B5YY14 2e-06 52 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAW1 2e-06 52 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O157:H7
B7L8A6 2e-06 52 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain 55989 / EAEC)
B7UMM1 2e-06 52 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZTW7 2e-06 52 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O139:H28 (strain E24377A / ETEC)
P25545 2.19e-06 52 22 4 242 3 cbbR HTH-type transcriptional regulator CbbR Xanthobacter flavus
P27102 2.19e-06 52 41 0 72 3 tcbR HTH-type transcriptional regulator TcbR Pseudomonas sp. (strain P51)
B7LUJ5 5.38e-06 50 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P52675 7.31e-06 48 27 2 135 3 cysB HTH-type transcriptional regulator CysB (Fragment) Thiocapsa roseopersicina
B2TU26 1.08e-05 49 24 6 257 3 hdfR HTH-type transcriptional regulator HdfR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P45099 1.35e-05 49 25 6 181 3 gcvA Glycine cleavage system transcriptional activator homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P52660 1.44e-05 49 29 6 137 3 blaA HTH-type transcriptional regulator BlaA Proteus vulgaris
P76369 1.98e-05 48 29 0 107 3 yeeY Uncharacterized HTH-type transcriptional regulator YeeY Escherichia coli (strain K12)
A1JI47 4.15e-05 48 28 4 150 3 hdfR HTH-type transcriptional regulator HdfR Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P55576 8.58e-05 47 28 3 130 3 NGR_a02420 Uncharacterized HTH-type transcriptional regulator y4mQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B1JQ39 0.000173 46 28 3 150 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66G51 0.000173 46 28 3 150 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRF4 0.000173 46 28 3 150 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis (strain Pestoides F)
Q1CNN4 0.000173 46 28 3 150 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Nepal516)
A9R8E7 0.000173 46 28 3 150 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Angola)
Q8ZAA7 0.000173 46 28 3 150 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis
B2JZG4 0.000173 46 28 3 150 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBT5 0.000173 46 28 3 150 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Antiqua)
A7FD20 0.000173 46 28 3 150 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P77333 0.000215 45 36 1 83 1 pgrR HTH-type transcriptional regulator PgrR Escherichia coli (strain K12)
P46068 0.00028 45 26 1 110 2 dsdC HTH-type transcriptional regulator DsdC Escherichia coli (strain K12)
Q01610 0.000358 45 35 1 85 3 PA2220 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0ACR0 0.000387 45 37 1 78 1 allS HTH-type transcriptional activator AllS Escherichia coli (strain K12)
P0ACR1 0.000387 45 37 1 78 3 allS HTH-type transcriptional activator AllS Escherichia coli O157:H7
P11720 0.000534 44 28 4 134 1 trpI HTH-type transcriptional regulator TrpI Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P52659 0.001 43 24 8 287 3 abaB HTH-type transcriptional regulator AbaB Streptomyces antibioticus

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS16945
Feature type CDS
Gene oxyR
Product DNA-binding transcriptional regulator OxyR
Location 10699 - 11610 (strand: -1)
Length 912 (nucleotides) / 303 (amino acids)

Contig

Accession term accessions NZ_VXKB01000007 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 196482 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_347
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00126 Bacterial regulatory helix-turn-helix protein, lysR family
PF03466 LysR substrate binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0583 Transcription (K) K DNA-binding transcriptional regulator, LysR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04761 LysR family transcriptional regulator, hydrogen peroxide-inducible genes activator Biofilm formation - Escherichia coli -

Protein Sequence

MNIRDLEYLVALSEHNHFRRAADACHVSQPTLSGQIRKLEDELGVMLLERTSRKVLFTQQGMLLVDQARTILREVKILEEMASLQGESMAGPLHIGLIPTIAPYLLPHIIPELHRLWPKLEMYLHEAQTQQLLAQLDSGKLDCAILARVKETGAFIEEPLFNEPMKLAVYDDHPWAARQDVEMHELAGEKLLMLEDGHCLRDQAMGFCFQAGAKEDTHFRATSMETLRNMVAAGSGITLLPDLAIPPEHKRDGVCYLSCSEPEPFREVILVYRPGSPLRSRYSQLAEAIRAKMCAYYQQEPPV

Flanking regions ( +/- flanking 50bp)

TGATGGATATCAATTGATTTTATCTATTAATCGCAGACGGAGAGACAGGCATGAATATCCGGGATTTGGAATATCTGGTTGCACTTTCAGAGCATAATCACTTTCGCCGGGCGGCTGATGCATGTCACGTCAGTCAGCCGACCCTGAGCGGACAGATTAGAAAACTGGAAGATGAGCTGGGTGTGATGCTGCTGGAGCGAACCAGCCGCAAAGTCTTGTTTACCCAGCAGGGAATGTTGCTGGTGGATCAGGCCCGGACCATTCTGCGTGAAGTGAAAATCCTGGAAGAGATGGCATCACTTCAGGGTGAAAGTATGGCAGGTCCGCTGCATATCGGGCTGATCCCGACGATTGCGCCGTATCTGCTGCCGCATATTATTCCTGAACTGCACCGGCTCTGGCCGAAACTTGAAATGTATCTTCATGAAGCACAAACGCAACAGTTGCTGGCGCAACTGGACAGTGGCAAGCTGGATTGCGCGATCTTGGCAAGAGTCAAAGAAACCGGCGCGTTTATTGAAGAGCCGCTGTTTAATGAGCCGATGAAACTGGCGGTTTATGATGATCATCCGTGGGCGGCACGTCAGGATGTGGAAATGCATGAGCTGGCGGGTGAAAAATTGCTGATGCTGGAAGACGGGCACTGTCTGCGCGACCAGGCTATGGGATTTTGTTTTCAGGCGGGCGCGAAAGAAGATACCCATTTCCGGGCAACAAGCATGGAAACGCTTCGCAATATGGTTGCGGCGGGCAGCGGGATTACTTTACTGCCGGATCTGGCTATTCCGCCGGAGCATAAACGCGACGGTGTGTGTTATCTCTCCTGCTCTGAGCCGGAGCCTTTCCGTGAAGTGATTCTGGTTTATCGTCCCGGTTCGCCGCTGCGCAGCCGTTACAGCCAACTGGCAGAAGCGATCCGTGCAAAAATGTGCGCGTATTATCAGCAGGAACCGCCGGTTTAAAATAACCGGTTCAGTCCGTTAAGGGCGGCAACACGGTAAGCTTCCGCCAT