Homologs in group_2266

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17430 FBDBKF_17430 90.3 Morganella morganii S1 phoR phosphate regulon sensor histidine kinase PhoR
EHELCC_17325 EHELCC_17325 90.3 Morganella morganii S2 phoR phosphate regulon sensor histidine kinase PhoR
NLDBIP_17870 NLDBIP_17870 90.3 Morganella morganii S4 phoR phosphate regulon sensor histidine kinase PhoR
LHKJJB_17790 LHKJJB_17790 90.3 Morganella morganii S3 phoR phosphate regulon sensor histidine kinase PhoR
HKOGLL_17800 HKOGLL_17800 90.3 Morganella morganii S5 phoR phosphate regulon sensor histidine kinase PhoR
PMI_RS00255 PMI_RS00255 65.3 Proteus mirabilis HI4320 phoR phosphate regulon sensor histidine kinase PhoR

Distribution of the homologs in the orthogroup group_2266

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2266

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P08400 0.0 550 63 0 430 1 phoR Phosphate regulon sensor protein PhoR Escherichia coli (strain K12)
P45608 0.0 549 60 0 429 3 phoR Phosphate regulon sensor protein PhoR Klebsiella pneumoniae
P45609 0.0 546 62 0 431 3 phoR Phosphate regulon sensor protein PhoR Shigella dysenteriae
P71380 1.99e-97 301 39 6 427 3 phoR Phosphate regulon sensor protein PhoR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P23621 4.4e-91 285 43 4 379 3 phoR Phosphate regulon sensor protein PhoR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P23545 1.09e-40 155 37 5 240 1 phoR Alkaline phosphatase synthesis sensor protein PhoR Bacillus subtilis (strain 168)
A0QR01 5.44e-40 150 35 1 231 1 senX3 Sensor-like histidine kinase SenX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q45614 1.53e-39 153 31 9 356 1 walK Sensor histidine kinase WalK Bacillus subtilis (strain 168)
P35164 5.75e-39 151 32 9 333 1 resE Sensor histidine kinase ResE Bacillus subtilis (strain 168)
A5A2P0 1.51e-38 147 30 11 357 3 walK Sensor protein kinase WalK (Fragment) Mammaliicoccus sciuri
P9WGK5 6.52e-37 142 34 1 232 1 senX3 Sensor-like histidine kinase SenX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGK4 6.52e-37 142 34 1 232 2 senX3 Sensor-like histidine kinase SenX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A601 6.52e-37 142 34 1 232 1 senX3 Sensor-like histidine kinase SenX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P54883 1.65e-36 142 35 2 237 3 senX3 Sensor-like histidine kinase SenX3 Mycobacterium leprae (strain TN)
Q9RDT3 2.17e-34 135 30 8 344 1 walK Sensor protein kinase WalK (Fragment) Staphylococcus aureus
Q6GKS6 9.64e-34 136 30 8 344 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain MRSA252)
Q7A215 1.1e-33 136 30 8 344 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain MW2)
A8YYU2 1.1e-33 136 30 8 344 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD71 1.1e-33 136 30 8 344 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain MSSA476)
Q7A8E0 1.1e-33 136 30 8 344 1 walK Sensor protein kinase WalK Staphylococcus aureus (strain N315)
Q7A305 1.1e-33 136 30 8 344 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJX6 1.1e-33 136 30 8 344 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain COL)
Q2YUQ2 1.1e-33 136 30 8 344 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INR0 1.1e-33 136 30 8 344 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain JH9)
Q2G2U4 1.1e-33 136 30 8 344 1 walK Sensor protein kinase WalK Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN7 1.1e-33 136 30 8 344 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain USA300)
A6TXG9 1.1e-33 136 30 8 344 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain JH1)
A7WWQ7 1.1e-33 136 30 8 344 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q4A159 1.26e-33 136 28 7 342 3 walK Sensor protein kinase WalK Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A6QD58 3.62e-33 135 30 8 344 3 walK Sensor protein kinase WalK Staphylococcus aureus (strain Newman)
Q4LAJ8 5.07e-33 134 28 7 342 3 walK Sensor protein kinase WalK Staphylococcus haemolyticus (strain JCSC1435)
Q8CU87 2.13e-32 132 29 10 347 1 walK Sensor protein kinase WalK Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK19 2.13e-32 132 29 10 347 1 walK Sensor protein kinase WalK Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q7A5H7 7.21e-32 130 32 6 242 1 srrB Sensor protein SrrB Staphylococcus aureus (strain N315)
Q99TZ9 7.21e-32 130 32 6 242 3 srrB Sensor protein SrrB Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8NWF3 8.65e-32 130 32 6 242 3 srrB Sensor protein SrrB Staphylococcus aureus (strain MW2)
Q6G973 8.65e-32 130 32 6 242 3 srrB Sensor protein SrrB Staphylococcus aureus (strain MSSA476)
Q5HFT1 8.65e-32 130 32 6 242 2 srrB Sensor protein SrrB Staphylococcus aureus (strain COL)
Q2FY80 8.65e-32 130 32 6 242 3 srrB Sensor protein SrrB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q6GGK7 8.82e-32 130 32 6 242 3 srrB Sensor protein SrrB Staphylococcus aureus (strain MRSA252)
Q9L523 8.99e-32 130 32 6 242 1 srrB Sensor protein SrrB Staphylococcus aureus
Q8DPL8 3.89e-31 127 28 5 387 1 walK Sensor histidine protein kinase/phosphatase WalK Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNH9 3.89e-31 127 28 5 387 1 walK Sensor histidine protein kinase/phosphatase WalK Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
O34638 1.37e-30 125 34 6 224 3 ykoH Sensor histidine kinase YkoH Bacillus subtilis (strain 168)
P30847 2.81e-30 125 29 6 281 1 baeS Signal transduction histidine-protein kinase BaeS Escherichia coli (strain K12)
Q55932 2.14e-27 116 32 3 219 1 rppB Sensor histidine kinase RppB Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O69729 5e-27 115 33 4 234 1 tcrY Probable sensor histidine kinase TcrY Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
O34206 9.43e-25 110 26 8 368 1 kinB Alginate biosynthesis sensor protein KinB Pseudomonas aeruginosa
P0AE82 1.5e-23 105 29 5 241 1 cpxA Sensor histidine kinase CpxA Escherichia coli (strain K12)
P0AE83 1.5e-23 105 29 5 241 3 cpxA Sensor protein CpxA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE84 1.5e-23 105 29 5 241 3 cpxA Sensor protein CpxA Escherichia coli O157:H7
A0A0H3GPN8 3.74e-23 104 28 4 241 2 cpxA Sensor histidine kinase CpxA Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
Q6GGZ4 3.63e-22 101 30 5 225 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain MRSA252)
Q7A0W5 3.84e-22 101 30 5 225 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain MW2)
Q6G9E7 3.84e-22 101 30 5 225 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain MSSA476)
Q7A5N3 3.84e-22 101 30 5 225 1 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain N315)
Q7A2R7 3.84e-22 101 30 5 225 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG05 3.84e-22 101 30 5 225 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain COL)
Q9KJN3 3.84e-22 101 30 5 225 1 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH24 3.84e-22 101 30 5 225 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain USA300)
Q2YY04 4.38e-22 101 30 5 225 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9ZHD4 7.91e-22 100 32 6 224 3 silS Probable sensor kinase SilS Salmonella typhimurium
E0X9C7 8.42e-22 102 30 6 237 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
E0X9C7 3.22e-13 75 23 14 387 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
P94414 8.62e-22 100 30 6 239 3 yclK Sensor histidine kinase YclK Bacillus subtilis (strain 168)
A5W4E3 9.57e-22 101 31 6 231 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A5W4E3 3.34e-13 75 23 14 387 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q54YZ9 1.43e-21 101 28 10 291 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
Q9RQQ9 1.93e-21 100 28 6 261 1 divL Sensor protein DivL Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P20169 2.13e-21 100 28 6 250 3 dspA Drug sensory protein A Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q06240 2.41e-21 98 27 8 260 1 vanS Sensor protein VanS Enterococcus faecium
P37894 3.37e-21 100 25 13 388 1 pleC Non-motile and phage-resistance protein Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P39764 3.61e-21 98 27 3 253 1 kinC Sporulation kinase C Bacillus subtilis (strain 168)
P0DMK6 5.34e-21 98 29 3 224 3 irlS Sensor protein IrlS Burkholderia pseudomallei (strain K96243)
Q9CCJ1 6.78e-21 98 27 5 240 3 mtrB Sensor histidine kinase MtrB Mycobacterium leprae (strain TN)
P0A4I6 7.88e-21 97 31 3 222 3 ciaH Sensor protein CiaH Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4I5 7.88e-21 97 31 3 222 3 ciaH Sensor protein CiaH Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P48027 9.8e-21 98 31 8 245 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
Q9KHI5 1.13e-20 98 32 9 237 1 cikA Circadian input-output histidine kinase CikA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8KIY1 1.21e-20 98 30 6 231 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
Q8KIY1 1.34e-09 63 23 12 386 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
Q55630 1.4e-20 96 28 8 251 1 sasA Adaptive-response sensory kinase SasA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5HPC4 1.84e-20 96 28 4 227 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CSL7 2.04e-20 96 27 4 227 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q4L6C5 2.09e-20 96 29 7 226 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus haemolyticus (strain JCSC1435)
Q9F8D7 2.19e-20 97 31 9 252 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
P0C0F7 2.2e-20 97 31 8 267 1 rpfC Sensory/regulatory protein RpfC Xanthomonas campestris pv. campestris (strain 8004)
P0C0F6 2.43e-20 97 31 8 267 1 rpfC Sensory/regulatory protein RpfC Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q49ZT9 2.76e-20 96 29 4 224 3 hssS Heme sensor protein HssS Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P77485 3.55e-20 95 31 5 224 1 cusS Sensor histidine kinase CusS Escherichia coli (strain K12)
Q87GU5 7e-20 95 28 4 237 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P9WGK8 9.39e-20 95 27 4 241 3 mtrB Sensor histidine kinase MtrB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P59963 9.39e-20 95 27 4 241 3 mtrB Sensor histidine kinase MtrB Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q93CB7 9.7e-20 95 27 5 239 3 mtrB Sensor histidine kinase MtrB Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P9WGK9 1.03e-19 95 27 4 241 1 mtrB Sensor histidine kinase MtrB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
I1WSZ3 1.08e-19 94 28 3 224 3 irlS Sensor protein IrlS Burkholderia pseudomallei (strain 1026b)
Q8FK37 1.64e-19 94 31 5 224 3 cusS Sensor histidine kinase CusS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEC4 2.41e-19 94 25 16 363 3 arcB Aerobic respiration control sensor protein ArcB Shigella flexneri
P0AEC3 2.41e-19 94 25 16 363 1 arcB Aerobic respiration control sensor protein ArcB Escherichia coli (strain K12)
P54302 2.55e-19 94 28 4 237 1 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio harveyi
Q08430 2.57e-19 93 26 5 241 3 kinB Sporulation kinase B Bacillus subtilis (strain 168)
P58363 2.61e-19 94 25 16 363 3 arcB Aerobic respiration control sensor protein ArcB Escherichia coli O157:H7
P39664 9.33e-19 91 26 6 336 1 sphS Sensor protein SphS Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q47745 1.22e-18 91 31 6 213 3 vanSB Sensor protein VanSB Enterococcus faecalis (strain ATCC 700802 / V583)
Q8XBY4 1.25e-18 91 31 4 229 3 cusS Sensor histidine kinase CusS Escherichia coli O157:H7
A9M715 1.55e-18 92 24 14 425 3 pdhS Cell-division control histidine kinase PdhS Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q8FZ86 1.62e-18 92 24 14 425 3 pdhS Cell-division control histidine kinase PdhS Brucella suis biovar 1 (strain 1330)
B0CI82 1.68e-18 92 24 14 425 3 pdhS Cell-division control histidine kinase PdhS Brucella suis (strain ATCC 23445 / NCTC 10510)
P30855 1.77e-18 92 23 13 401 1 evgS Sensor protein EvgS Escherichia coli (strain K12)
B2J946 2.44e-18 89 28 7 231 3 sasA Adaptive-response sensory kinase SasA Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q57BR6 2.48e-18 91 24 14 425 1 pdhS Cell-division control histidine kinase PdhS Brucella abortus biovar 1 (strain 9-941)
Q2YRB4 2.48e-18 91 24 14 425 3 pdhS Cell-division control histidine kinase PdhS Brucella abortus (strain 2308)
B2S758 2.48e-18 91 24 14 425 3 pdhS Cell-division control histidine kinase PdhS Brucella abortus (strain S19)
P58402 2.5e-18 91 26 8 276 3 evgS Sensor protein EvgS Escherichia coli O157:H7
Q8YIM6 2.59e-18 91 24 14 425 3 pdhS Cell-division control histidine kinase PdhS Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P0AEC5 2.89e-18 91 31 9 250 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli (strain K12)
P0AEC6 2.89e-18 91 31 9 250 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEC7 2.89e-18 91 31 9 250 3 barA Signal transduction histidine-protein kinase BarA Escherichia coli O157:H7
Q49XM6 3.05e-18 90 28 3 223 3 arlS Signal transduction histidine-protein kinase ArlS Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A5VRX4 3.07e-18 91 24 14 425 3 pdhS Cell-division control histidine kinase PdhS Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P59342 3.11e-18 90 31 9 250 3 barA Signal transduction histidine-protein kinase BarA Shigella flexneri
Q52969 3.27e-18 90 27 5 273 3 R01002 Uncharacterized sensor-like histidine kinase R01002 Rhizobium meliloti (strain 1021)
B7KFU0 3.33e-18 89 29 6 225 3 sasA Adaptive-response sensory kinase SasA Gloeothece citriformis (strain PCC 7424)
Q04943 3.58e-18 90 29 5 234 3 afsQ2 Signal transduction histidine-protein kinase AfsQ2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B1WYT4 6.17e-18 88 28 4 229 3 sasA Adaptive-response sensory kinase SasA Crocosphaera subtropica (strain ATCC 51142 / BH68)
A0R3I7 7.99e-18 89 32 11 250 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8X524 8.79e-18 88 30 6 251 2 qseC Sensor protein QseC Escherichia coli O157:H7
P40719 1.14e-17 88 30 6 251 1 qseC Sensor protein QseC Escherichia coli (strain K12)
A0QTK3 1.26e-17 88 27 4 236 3 mtrB Sensor histidine kinase MtrB Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q869S5 2.14e-17 88 29 6 230 1 dokA Hybrid signal transduction protein dokA Dictyostelium discoideum
O33071 2.38e-17 87 31 4 221 3 prrB Sensor-type histidine kinase PrrB Mycobacterium leprae (strain TN)
Q06067 2.59e-17 87 23 11 341 1 atoS Signal transduction histidine-protein kinase AtoS Escherichia coli (strain K12)
Q2T0V9 4.13e-17 87 27 4 229 3 atsR Sensor histidine kinase AtsR Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q56128 4.47e-17 87 29 9 244 3 rcsC Sensor histidine kinase RcsC Salmonella typhi
P16497 4.89e-17 87 23 5 260 1 kinA Sporulation kinase A Bacillus subtilis (strain 168)
P58662 4.98e-17 87 29 9 244 3 rcsC Sensor histidine kinase RcsC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O34989 5.07e-17 86 28 7 229 3 yvrG Sensor histidine kinase YvrG Bacillus subtilis (strain 168)
P51392 5.88e-17 86 23 14 382 3 ycf26 Uncharacterized sensor-like histidine kinase ycf26 Porphyra purpurea
Q8DKG0 6.41e-17 86 28 4 228 1 cikA Circadian input-output histidine kinase CikA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B7K3M6 6.55e-17 85 27 4 225 3 sasA Adaptive-response sensory kinase SasA Rippkaea orientalis (strain PCC 8801 / RF-1)
Q8GP19 7.14e-17 85 29 9 247 1 rssA Swarming motility regulation sensor protein RssA Serratia marcescens
Q03228 8.97e-17 86 26 7 287 1 divJ Histidine protein kinase DivJ Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8YR50 9.19e-17 85 27 9 237 3 sasA Adaptive-response sensory kinase SasA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8XA47 1.02e-16 85 26 3 227 1 qseE Sensor histidine kinase QseE Escherichia coli O157:H7
Q3M8A7 1.12e-16 85 27 9 238 3 sasA Adaptive-response sensory kinase SasA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
T2KMF4 1.15e-16 86 25 7 245 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
Q4L8M0 1.74e-16 84 26 5 227 3 hssS Heme sensor protein HssS Staphylococcus haemolyticus (strain JCSC1435)
P0DMC5 1.76e-16 85 29 8 233 1 rcsC Sensor histidine kinase RcsC Escherichia coli (strain K12)
P0DMC6 2.09e-16 85 29 8 233 1 rcsC Sensor histidine kinase RcsC Escherichia coli
Q8DMT2 2.1e-16 84 27 5 232 1 sasA Adaptive-response sensory kinase SasA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q54SP4 2.19e-16 85 28 7 244 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q54SP4 2.78e-12 72 24 7 268 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
A6X5X4 2.22e-16 85 24 14 389 3 pdhS Cell-division control histidine kinase PdhS Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
P74111 2.29e-16 85 28 8 239 1 cikA Circadian input-output histidine kinase CikA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9APE0 2.72e-16 84 29 5 218 3 zraS Sensor histidine kinase ZraS Klebsiella oxytoca
Q1XD95 2.73e-16 84 26 7 253 3 ycf26 Uncharacterized sensor-like histidine kinase ycf26 Neopyropia yezoensis
P52101 3.55e-16 84 26 3 227 1 glrK Sensor histidine kinase GlrK Escherichia coli (strain K12)
Q5HLN1 3.64e-16 83 28 4 212 3 hssS Heme sensor protein HssS Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q54YH4 4.15e-16 84 26 6 231 1 dhkB Hybrid signal transduction histidine kinase B Dictyostelium discoideum
Q7U871 4.81e-16 82 32 10 224 3 sasA Adaptive-response sensory kinase SasA Parasynechococcus marenigrum (strain WH8102)
Q02482 4.98e-16 84 25 15 370 3 Sfri_3689 Putative sensor protein Sfri_3689 Shewanella frigidimarina (strain NCIMB 400)
P9WGK7 5.36e-16 83 29 4 220 1 prrB Sensor-type histidine kinase PrrB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGK6 5.36e-16 83 29 4 220 3 prrB Sensor-type histidine kinase PrrB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z9 5.36e-16 83 29 4 220 3 prrB Sensor-type histidine kinase PrrB Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q07737 5.76e-16 83 28 8 232 3 chvG Sensor protein ChvG Agrobacterium fabrum (strain C58 / ATCC 33970)
O14002 5.86e-16 84 26 11 354 3 mak2 Peroxide stress-activated histidine kinase mak2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8D5Z6 6.1e-16 84 27 10 256 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain CMCP6)
Q7MD16 6.38e-16 84 27 10 256 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain YJ016)
O32193 6.81e-16 82 24 5 224 1 cssS Sensor histidine kinase CssS Bacillus subtilis (strain 168)
Q9HUI3 9.68e-16 83 28 6 242 3 aruS Sensor histidine kinase AruS Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P72292 9.92e-16 82 29 9 234 3 chvG Sensor protein ChvG Rhizobium meliloti (strain 1021)
Q08408 1.12e-15 82 27 6 240 3 rprX Sensor protein RprX Bacteroides fragilis (strain YCH46)
Q9SXL4 1.25e-15 83 25 10 297 1 AHK1 Histidine kinase 1 Arabidopsis thaliana
P14377 1.29e-15 82 26 3 221 1 zraS Sensor histidine kinase ZraS Escherichia coli (strain K12)
Q7BWI3 1.57e-15 81 27 8 229 3 sasA Adaptive-response sensory kinase SasA Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A1A696 1.67e-15 82 26 7 285 2 HK3 Probable histidine kinase 3 Oryza sativa subsp. japonica
A2WYI4 1.7e-15 82 26 7 285 2 HK3 Probable histidine kinase 3 Oryza sativa subsp. indica
A0PWB3 2.18e-15 81 29 10 237 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium ulcerans (strain Agy99)
Q8CRA8 2.41e-15 81 27 4 212 3 hssS Heme sensor protein HssS Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8X614 2.52e-15 81 26 3 221 3 zraS Sensor histidine kinase ZraS Escherichia coli O157:H7
P42245 2.92e-15 79 25 3 231 3 ycbM Sensor histidine kinase YcbM Bacillus subtilis (strain 168)
P36557 3.09e-15 80 30 6 211 1 basS Sensor protein BasS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P30844 4.08e-15 79 31 7 219 1 basS Sensor protein BasS Escherichia coli (strain K12)
O31661 4.16e-15 81 25 8 250 1 kinE Sporulation kinase E Bacillus subtilis (strain 168)
Q8NV46 4.99e-15 80 28 2 224 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain MW2)
Q6G6V8 4.99e-15 80 28 2 224 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain MSSA476)
O31671 5.16e-15 80 24 3 215 1 kinD Sporulation kinase D Bacillus subtilis (strain 168)
Q3AYV8 6.34e-15 79 31 9 218 3 sasA Adaptive-response sensory kinase SasA Synechococcus sp. (strain CC9902)
Q47457 6.82e-15 80 27 3 226 3 pcoS Probable sensor protein PcoS Escherichia coli
P33113 6.9e-15 79 28 6 228 3 spaK Sensor histidine kinase SpaK Bacillus subtilis
E5KK10 7.82e-15 80 26 4 221 1 filI Methanogenesis regulatory histidine kinase FilI Methanothrix harundinacea (strain 6Ac)
Q9HV31 7.88e-15 79 28 6 208 2 pmrB Sensor protein kinase PmrB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0QBR0 9.97e-15 79 28 11 249 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium avium (strain 104)
Q551X9 1.09e-14 80 31 8 246 3 dhkF Hybrid signal transduction histidine kinase F Dictyostelium discoideum
Q5A599 1.15e-14 80 26 10 293 1 NIK1 Histidine protein kinase NIK1 Candida albicans (strain SC5314 / ATCC MYA-2876)
P96368 1.23e-14 79 33 6 215 1 trcS Sensor histidine kinase TrcS Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q2JKD9 1.3e-14 78 26 8 235 3 sasA Adaptive-response sensory kinase SasA Synechococcus sp. (strain JA-2-3B'a(2-13))
Q742C0 1.52e-14 79 28 11 249 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A1A697 1.87e-14 79 25 7 281 2 HK5 Probable histidine kinase 5 Oryza sativa subsp. japonica
Q6GE72 2.24e-14 78 27 2 224 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain MRSA252)
A3Q5L8 3.15e-14 78 30 12 250 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium sp. (strain JLS)
A8Z553 3.51e-14 77 27 2 224 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain USA300 / TCH1516)
A6QJK4 3.51e-14 77 27 2 224 1 hssS Heme sensor protein HssS Staphylococcus aureus (strain Newman)
Q5HDJ3 3.51e-14 77 27 2 224 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain COL)
Q2FVQ8 3.51e-14 77 27 2 224 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED4 3.51e-14 77 27 2 224 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain USA300)
Q7A3X0 3.61e-14 77 27 2 224 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain N315)
Q99RR5 3.61e-14 77 27 2 224 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE3 3.61e-14 77 27 2 224 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain JH9)
A6U489 3.61e-14 77 27 2 224 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain JH1)
A7X5Y6 3.61e-14 77 27 2 224 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q1B3X9 4.27e-14 77 30 12 250 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium sp. (strain MCS)
A1UL69 4.27e-14 77 30 12 250 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium sp. (strain KMS)
Q54U87 4.64e-14 78 26 9 255 1 dhkA Hybrid signal transduction histidine kinase A Dictyostelium discoideum
P18392 5e-14 77 26 4 221 1 rstB Sensor protein RstB Escherichia coli (strain K12)
Q2YZ23 5.46e-14 77 27 2 224 3 hssS Heme sensor protein HssS Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8Z3P2 6.78e-14 76 31 7 203 3 qseC Sensor protein QseC Salmonella typhi
Q9C5U1 6.79e-14 77 26 7 272 1 AHK3 Histidine kinase 3 Arabidopsis thaliana
Q8ZLZ9 7.28e-14 76 30 7 205 3 qseC Sensor protein QseC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B0JK50 9.05e-14 75 25 8 255 3 sasA Adaptive-response sensory kinase SasA Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q2FWH7 1.54e-13 76 28 10 243 1 kdpD Sensor histidine kinase KdpD Staphylococcus aureus (strain NCTC 8325 / PS 47)
P37461 2.8e-13 75 27 5 217 2 zraS Sensor histidine kinase ZraS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z332 3.01e-13 74 27 5 217 3 zraS Sensor histidine kinase ZraS Salmonella typhi
P21865 3.37e-13 75 28 7 238 1 kdpD Sensor protein KdpD Escherichia coli (strain K12)
Q3S4A7 4.94e-13 74 26 8 250 1 AHK5 Histidine kinase 5 Arabidopsis thaliana
A1KHB8 6.27e-13 73 30 8 209 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X3 6.27e-13 73 30 8 209 1 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9P896 6.74e-13 74 25 13 353 3 tcsA Two-component system protein A Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q8CTI3 6.84e-13 73 26 6 240 3 saeS Histidine protein kinase SaeS Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR29 6.84e-13 73 26 6 240 3 saeS Histidine protein kinase SaeS Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q54RP6 6.93e-13 74 25 17 382 3 dhkL Hybrid signal transduction histidine kinase L Dictyostelium discoideum
P94608 7.1e-13 74 24 5 234 3 kdpD Sensor protein KdpD Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P9WGL1 7.9e-13 73 30 8 209 1 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL0 7.9e-13 73 30 8 209 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U124 7.9e-13 73 30 8 209 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q06904 8.01e-13 73 32 2 113 1 sasA Adaptive-response sensory kinase SasA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q86CZ2 9.46e-13 73 27 10 254 1 dhkK Hybrid signal transduction histidine kinase K Dictyostelium discoideum
Q2JWK9 9.7e-13 72 26 8 232 3 sasA Adaptive-response sensory kinase SasA Synechococcus sp. (strain JA-3-3Ab)
P45336 1.04e-12 73 28 6 224 1 qseC Sensor protein QseC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A1TEL6 1.28e-12 72 29 9 232 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q9Z5G7 1.42e-12 72 29 9 237 3 mprB Signal transduction histidine-protein kinase/phosphatase MprB Mycobacterium leprae (strain TN)
P08401 1.57e-12 72 30 6 202 1 creC Sensor protein CreC Escherichia coli (strain K12)
Q9I4N4 1.78e-12 72 23 11 362 3 fleS Sensor protein kinase FleS Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q44007 2.47e-12 72 27 6 224 2 czcS Sensor protein CzcS Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P41406 2.49e-12 72 27 6 213 3 envZ Sensor histidine kinase EnvZ Salmonella typhi
P0A4I8 2.63e-12 71 28 5 227 3 cutS Sensor protein CutS Streptomyces lividans
P0A4I7 2.63e-12 71 28 5 227 3 cutS Sensor protein CutS Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q44930 3.32e-12 71 26 6 230 4 gtcS Sensor protein GtcS Aneurinibacillus migulanus
P40330 3.67e-12 72 28 6 238 3 bvgS Virulence sensor protein BvgS Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P08982 4.55e-12 71 27 6 213 3 envZ Sensor histidine kinase EnvZ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NIL4 4.55e-12 71 27 6 213 3 envZ Sensor histidine kinase EnvZ Salmonella typhimurium (strain SL1344)
Q03069 6.38e-12 70 20 5 221 3 degM Sensor protein DegM Bacillus sp. (strain B21-2)
P16575 6.38e-12 71 24 14 398 1 bvgS Virulence sensor protein BvgS Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7V6P7 7.25e-12 70 29 10 231 3 sasA Adaptive-response sensory kinase SasA Prochlorococcus marinus (strain MIT 9313)
Q5AHA0 7.94e-12 71 27 7 240 2 CHK1 Histidine protein kinase 1 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q9P7Q7 8.24e-12 71 26 5 234 3 mak1 Peroxide stress-activated histidine kinase mak1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q0IBF4 1.01e-11 69 31 2 114 3 sasA Adaptive-response sensory kinase SasA Synechococcus sp. (strain CC9311)
A2C884 1.86e-11 68 32 2 115 3 sasA Adaptive-response sensory kinase SasA Prochlorococcus marinus (strain MIT 9303)
P26762 1.88e-11 70 27 6 238 3 bvgS Virulence sensor protein BvgS Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A7HD43 2.14e-11 68 24 3 217 1 gchK Globin-coupled histidine kinase Anaeromyxobacter sp. (strain Fw109-5)
Q02541 2.17e-11 69 23 3 220 3 copS Sensor protein CopS Pseudomonas syringae pv. tomato
A0A4P7TSF2 2.57e-11 68 26 6 212 1 envZ Sensor histidine kinase EnvZ Shigella flexneri serotype 5a (strain M90T)
P0AEJ5 2.57e-11 68 26 6 212 1 envZ Sensor histidine kinase EnvZ Shigella flexneri
P0AEJ4 2.57e-11 68 26 6 212 1 envZ Sensor histidine kinase EnvZ Escherichia coli (strain K12)
P19906 3.86e-11 67 26 13 275 3 ntrB Sensory histidine kinase/phosphatase NtrB Vibrio alginolyticus
Q55168 4.52e-11 68 25 8 234 1 cph1 Phytochrome-like protein Cph1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q840P7 4.53e-11 67 23 6 246 1 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain Newman)
Q7A1J2 4.58e-11 67 23 6 246 3 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain MW2)
Q6GBC5 4.58e-11 67 23 6 246 3 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain MSSA476)
Q7A6V4 4.58e-11 67 23 6 246 1 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain N315)
Q99VR8 4.58e-11 67 23 6 246 3 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YSM6 4.58e-11 67 23 6 246 3 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GIT7 4.62e-11 67 23 6 246 3 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain MRSA252)
Q5HHW5 4.88e-11 67 23 6 246 1 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain COL)
Q2G2U1 4.88e-11 67 23 6 246 1 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT5 4.88e-11 67 23 6 246 3 saeS Histidine protein kinase SaeS Staphylococcus aureus (strain USA300)
Q31AE8 4.94e-11 67 26 10 247 3 sasA Adaptive-response sensory kinase SasA Prochlorococcus marinus (strain MIT 9312)
P44578 7.64e-11 66 30 9 209 3 arcB Aerobic respiration control sensor protein ArcB homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P42422 1.11e-10 66 23 6 228 3 yxdK Sensor histidine kinase YxdK Bacillus subtilis (strain 168)
P33639 1.18e-10 67 25 9 226 1 pilS Sensor protein kinase PilS Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q70FG9 1.32e-10 66 29 10 234 3 pmrB Sensor histidine kinase PmrB Pectobacterium parmentieri
A8G5E7 1.6e-10 65 25 10 247 3 sasA Adaptive-response sensory kinase SasA Prochlorococcus marinus (strain MIT 9215)
Q9KLK7 2.01e-10 66 24 8 264 1 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9M7M1 2.48e-10 66 23 7 254 2 ETR1 Ethylene receptor Prunus persica
Q9XH57 2.62e-10 66 25 7 248 2 ETR2 Ethylene receptor 2 Pelargonium hortorum
A3PDI2 2.92e-10 65 26 10 247 3 sasA Adaptive-response sensory kinase SasA Prochlorococcus marinus (strain MIT 9301)
P45675 3.03e-10 65 26 7 246 3 None Nitrogen regulation protein NtrY homolog Azospirillum brasilense
P76339 3.52e-10 65 27 7 206 1 hprS Sensor histidine kinase HprS Escherichia coli (strain K12)
A2BRQ6 3.89e-10 64 25 10 247 3 sasA Adaptive-response sensory kinase SasA Prochlorococcus marinus (strain AS9601)
A2YFR6 9.42e-10 64 41 0 78 3 HK1 Probable histidine kinase 1 Oryza sativa subsp. indica
A3BE68 9.59e-10 64 41 0 78 2 HK1 Probable histidine kinase 1 Oryza sativa subsp. japonica
P06218 9.73e-10 63 24 12 348 3 ntrB Sensory histidine kinase/phosphatase NtrB Klebsiella oxytoca
Q7V113 1.1e-09 63 25 9 238 3 sasA Adaptive-response sensory-kinase SasA Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q7A6Z3 1.13e-09 63 23 8 249 1 graS Sensor protein kinase GraS Staphylococcus aureus (strain N315)
Q99VW1 1.13e-09 63 23 8 249 1 graS Sensor histidine kinase GraS Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IQL3 1.13e-09 63 23 8 249 3 graS Sensor protein kinase GraS Staphylococcus aureus (strain JH9)
A6TZD7 1.13e-09 63 23 8 249 3 graS Sensor protein kinase GraS Staphylococcus aureus (strain JH1)
A7WZC5 1.13e-09 63 23 8 249 3 graS Sensor protein kinase GraS Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6GJ10 1.14e-09 63 23 8 249 3 graS Sensor protein kinase GraS Staphylococcus aureus (strain MRSA252)
Q8ZPP5 1.25e-09 64 27 8 235 1 ssrA Sensor histidine kinase SsrA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P39453 1.56e-09 63 27 9 246 1 torS Sensor protein TorS Escherichia coli (strain K12)
A8Z182 1.85e-09 62 23 8 249 3 graS Sensor protein kinase GraS Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW9 1.85e-09 62 23 8 249 3 graS Sensor protein kinase GraS Staphylococcus aureus (strain Newman)
Q5HI08 1.85e-09 62 23 8 249 1 graS Sensor histidine kinase GraS Staphylococcus aureus (strain COL)
Q2G0D9 1.85e-09 62 23 8 249 1 graS Sensor histidine kinase GraS Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIX9 1.85e-09 62 23 8 249 3 graS Sensor protein kinase GraS Staphylococcus aureus (strain USA300)
Q2YSS1 1.9e-09 62 23 8 249 3 graS Sensor protein kinase GraS Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9XH58 2.01e-09 63 24 7 245 2 ETR1 Ethylene receptor 1 Pelargonium hortorum
Q8NXR5 2.08e-09 62 23 8 249 1 graS Sensor protein kinase GraS Staphylococcus aureus (strain MW2)
Q6GBH0 2.08e-09 62 23 8 249 3 graS Sensor protein kinase GraS Staphylococcus aureus (strain MSSA476)
Q9LCC2 2.13e-09 63 27 9 231 3 aphA Cyanobacterial phytochrome A Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P58356 2.24e-09 63 27 9 245 3 torS Sensor protein TorS Escherichia coli O157:H7
Q8E3C7 2.47e-09 62 25 7 207 3 dltS Sensor protein DltS Streptococcus agalactiae serotype III (strain NEM316)
Q9R6X3 2.7e-09 63 25 10 230 3 bphB Cyanobacterial phytochrome B Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P59340 3.28e-09 62 24 13 352 3 dcuS Sensor histidine kinase DcuS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEC8 3.56e-09 62 24 13 352 1 dcuS Sensor histidine kinase DcuS Escherichia coli (strain K12)
P0AEC9 3.56e-09 62 24 13 352 3 dcuS Sensor histidine kinase DcuS Escherichia coli O157:H7
Q8DXQ8 3.59e-09 62 25 7 207 3 dltS Sensor protein DltS Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P59341 3.62e-09 62 24 13 352 3 dcuS Sensor histidine kinase DcuS Shigella flexneri
P96601 4.05e-09 62 25 11 279 3 dctS Probable C4-dicarboxylate sensor kinase Bacillus subtilis (strain 168)
Q95PI2 5.97e-09 62 27 9 264 1 dhkC Hybrid signal transduction histidine kinase C Dictyostelium discoideum
Q8CTL4 6.48e-09 60 25 8 216 3 graS Sensor histidine kinase GraS Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR80 6.48e-09 60 25 8 216 3 graS Sensor histidine kinase GraS Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O82436 7.22e-09 61 25 9 247 2 ETR1 Ethylene receptor 1 Cucumis melo var. cantalupensis
Q41342 9.89e-09 61 24 8 248 1 ETR1 Ethylene receptor 1 Solanum lycopersicum
P10955 1.19e-08 60 22 13 372 1 fixL Sensor protein FixL Rhizobium meliloti (strain 1021)
Q9HWR3 1.27e-08 60 23 3 205 1 bphP Bacteriophytochrome Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9SSY6 1.28e-08 60 23 7 257 2 ETR1 Ethylene receptor 1 Cucumis sativus
Q9K620 1.46e-08 59 25 7 228 3 bceS Sensor protein BceS Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P0AFB7 1.63e-08 59 24 12 348 3 glnL Sensory histidine kinase/phosphatase NtrB Shigella flexneri
P0AFB5 1.63e-08 59 24 12 348 1 glnL Sensory histidine kinase/phosphatase NtrB Escherichia coli (strain K12)
P0AFB6 1.63e-08 59 24 12 348 3 glnL Sensory histidine kinase/phosphatase NtrB Escherichia coli O157:H7
Q9I0I2 1.8e-08 60 25 6 221 3 carS Sensor protein kinase CarS Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O81122 1.81e-08 60 22 7 254 2 ETR1 Ethylene receptor Malus domestica
Q9KM66 1.89e-08 60 20 8 273 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9C5U2 2.51e-08 60 40 0 70 1 AHK2 Histidine kinase 2 Arabidopsis thaliana
Q9C5U2 2.47e-05 50 25 4 177 1 AHK2 Histidine kinase 2 Arabidopsis thaliana
Q49VK4 3.3e-08 58 23 7 246 3 graS Sensor histidine kinase GraS Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9HZ47 3.98e-08 58 23 7 232 1 gtrS Sensor histidine kinase GtrS Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8DMC5 4.15e-08 58 24 5 236 1 hik2 Sensor histidine kinase Hik2 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P49333 6.71e-08 58 24 5 218 1 ETR1 Ethylene receptor 1 Arabidopsis thaliana
Q92H24 9.67e-08 57 29 3 117 3 RC0948 Putative sensor histidine kinase NtrY-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q54W36 1.38e-07 57 40 0 80 3 dhkH Hybrid signal transduction histidine kinase H Dictyostelium discoideum
Q54W36 0.000571 46 26 6 173 3 dhkH Hybrid signal transduction histidine kinase H Dictyostelium discoideum
O25026 1.4e-07 57 22 13 316 1 flgS Sensor histidine kinase FlgS Helicobacter pylori (strain ATCC 700392 / 26695)
P26489 1.46e-07 57 23 16 403 3 fixL Sensor protein FixL Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P18540 2.51e-07 56 24 8 248 3 virA Wide host range VirA protein Agrobacterium fabrum (strain C58 / ATCC 33970)
Q86AT9 2.51e-07 57 37 0 78 3 dhkI-1 Hybrid signal transduction histidine kinase I Dictyostelium discoideum
Q4L482 3.65e-07 55 22 7 214 3 graS Sensor histidine kinase GraS Staphylococcus haemolyticus (strain JCSC1435)
Q68WC5 3.66e-07 56 31 3 120 3 RT0603 Putative sensor histidine kinase NtrY-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P10047 3.93e-07 55 24 6 210 3 dctB C4-dicarboxylate transport sensor protein DctB Rhizobium leguminosarum
P9WGL3 4.02e-07 56 21 5 223 1 kdpD Sensor protein KdpD Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL2 4.05e-07 56 21 5 223 3 kdpD Sensor protein KdpD Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P39928 4.05e-07 56 39 0 69 1 SLN1 Osmosensing histidine protein kinase SLN1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9ZCU7 4.36e-07 55 24 8 238 3 RP614 Putative sensor histidine kinase NtrY-like Rickettsia prowazekii (strain Madrid E)
Q9RC53 4.69e-07 55 21 8 337 3 citS Sensor protein CitS Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O49230 5.73e-07 55 23 6 235 2 ETR1 Ethylene receptor 1 Brassica oleracea
P0A2D9 6.25e-07 54 25 10 232 3 glnL Sensory histidine kinase/phosphatase NtrB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2E0 6.25e-07 54 25 10 232 3 glnL Sensory histidine kinase/phosphatase NtrB Salmonella typhi
P23222 6.29e-07 55 21 12 384 1 fixL Sensor protein FixL Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9I4F8 7.51e-07 54 24 6 227 3 phoQ Two-component sensor PhoQ Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P07168 7.83e-07 55 25 8 248 3 virA Wide host range VirA protein Rhizobium radiobacter
Q82EB2 7.92e-07 54 27 7 197 3 cseC Sensor protein CseC Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P07167 8.2e-07 55 24 10 255 3 virA Limited host range VirA protein Rhizobium radiobacter
P10799 8.77e-07 55 23 9 294 1 virA Wide host range VirA protein Agrobacterium tumefaciens (strain 15955)
A1A698 8.78e-07 55 40 0 70 2 HK4 Probable histidine kinase 4 Oryza sativa subsp. japonica
A1A698 0.000829 45 25 4 143 2 HK4 Probable histidine kinase 4 Oryza sativa subsp. japonica
O49187 1.2e-06 54 24 9 252 2 ETR2 Ethylene receptor 2 Solanum lycopersicum
O34971 1.39e-06 54 25 9 244 3 kdpD Sensor protein KdpD Rathayibacter rathayi
P0DM80 1.49e-06 53 23 5 212 1 phoQ Virulence sensor histidine kinase PhoQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP94 1.49e-06 53 23 5 212 2 phoQ Virulence sensor histidine kinase PhoQ Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA0 1.49e-06 53 23 5 212 1 phoQ Virulence sensor histidine kinase PhoQ Salmonella typhimurium (strain SL1344)
D0ZV89 1.49e-06 53 23 5 212 1 phoQ Virulence sensor histidine kinase PhoQ Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ0 1.49e-06 53 23 5 212 3 phoQ Virulence sensor histidine kinase PhoQ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57QC4 1.49e-06 53 23 5 212 3 phoQ Virulence sensor histidine kinase PhoQ Salmonella choleraesuis (strain SC-B67)
Q8Z7H3 1.52e-06 53 23 5 212 3 phoQ Virulence sensor histidine kinase PhoQ Salmonella typhi
Q8DN03 1.8e-06 53 24 7 229 3 hk06 Sensor histidine protein kinase HK06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZM62 1.8e-06 53 24 7 229 3 hk06 Sensor histidine protein kinase HK06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q04804 2.29e-06 53 24 7 223 1 pfeS Sensor protein PfeS Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q04850 2.41e-06 53 22 13 344 3 ntrY Nitrogen regulation protein NtrY Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q53RH0 2.53e-06 53 24 6 244 2 ERS1 Probable ethylene response sensor 1 Oryza sativa subsp. japonica
A2XL32 2.53e-06 53 24 6 244 2 ERS1 Probable ethylene response sensor 1 Oryza sativa subsp. indica
P09431 2.71e-06 52 26 10 227 3 ntrB Sensory histidine kinase/phosphatase NtrB Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q5A872 3.04e-06 53 37 0 69 1 SLN1 Histidine protein kinase SLN1 Candida albicans (strain SC5314 / ATCC MYA-2876)
P73276 3.7e-06 52 31 2 101 1 hik2 Sensor histidine kinase Hik2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O35044 4.25e-06 52 23 9 230 1 bceS Sensor protein BceS Bacillus subtilis (strain 168)
A7N6S2 4.92e-06 52 22 8 285 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio campbellii (strain ATCC BAA-1116)
Q9P4U6 5.5e-06 52 35 0 78 1 tcsB Two-component system protein B Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q8THF6 6.68e-06 52 27 0 113 1 msmS Methyl sulfide methyltransferase-associated sensor Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
P37739 7.3e-06 52 25 8 232 3 dctS C4-dicarboxylate transport sensor protein DctS Rhodobacter capsulatus
Q8FIB8 9.64e-06 51 21 3 214 3 phoQ Sensor protein PhoQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9C5U0 9.7e-06 52 34 1 84 1 AHK4 Histidine kinase 4 Arabidopsis thaliana
Q9C5U0 0.000197 47 31 6 137 1 AHK4 Histidine kinase 4 Arabidopsis thaliana
Q83RR1 9.81e-06 51 21 3 214 3 phoQ Virulence sensor protein PhoQ Shigella flexneri
P23837 1.01e-05 51 21 3 214 1 phoQ Sensor protein PhoQ Escherichia coli (strain K12)
Q8X739 1.36e-05 50 21 3 214 3 phoQ Sensor protein PhoQ Escherichia coli O157:H7
Q7D9K1 1.49e-05 50 29 3 174 3 MT0630 Probable sensor histidine kinase HK Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P10578 1.54e-05 50 23 15 347 3 ntrB Sensory histidine kinase/phosphatase NtrB Bradyrhizobium sp. (strain RP501 Parasponia)
Q4UMD4 1.82e-05 50 29 2 104 3 RF_0427 Putative sensor histidine kinase NtrY-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P15939 2e-05 50 29 3 119 4 nodV Nodulation protein V Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A1A699 2.19e-05 50 32 0 80 1 HK6 Probable histidine kinase 6 Oryza sativa subsp. japonica
Q1RJB3 4.49e-05 49 26 9 226 3 RBE_0470 Putative sensor histidine kinase NtrY-like Rickettsia bellii (strain RML369-C)
Q54Q69 6.32e-05 49 26 4 145 3 dhkG Hybrid signal transduction histidine kinase G Dictyostelium discoideum
P0DOA0 7.59e-05 48 23 11 274 1 cckA Sensor kinase CckA Brucella abortus (strain 2308)
Q9ZEP3 8e-05 48 26 8 198 1 cseC Sensor protein CseC Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P30663 0.000129 47 22 8 240 1 nifL Nitrogen fixation regulatory protein Azotobacter vinelandii
P41503 0.000138 47 25 15 296 3 ntrB Sensory histidine kinase/phosphatase NtrB Rhizobium leguminosarum bv. phaseoli
Q9RZA4 0.000175 47 22 7 249 1 bphP Bacteriophytochrome Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
P42707 0.000449 46 24 8 211 3 nisK Nisin biosynthesis sensor protein NisK Lactococcus lactis subsp. lactis
Q38846 0.000479 46 22 4 217 1 ERS1 Ethylene response sensor 1 Arabidopsis thaliana
Q9HWA7 0.000511 46 23 7 260 1 pprA Two-component sensor PprA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS16605
Feature type CDS
Gene phoR
Product phosphate regulon sensor histidine kinase PhoR
Location 141038 - 142333 (strand: -1)
Length 1296 (nucleotides) / 431 (amino acids)

Contig

Accession term accessions NZ_VXKB01000006 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 212134 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2266
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00512 His Kinase A (phospho-acceptor) domain
PF00989 PAS fold
PF02518 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
PF11808 Phosphate regulon sensor protein PhoR

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG5002 Signal transduction mechanisms (T) T Sensor histidine kinase WalK

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07636 two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC:2.7.13.3] Two-component system -

Protein Sequence

MLERLSWKKIVLELLVFCLPALILSLFFGFTGWFLAAALFAVTLWHGYNLLKLSDWLWLDRSVLPPPGRSSWEPIFYGIYQLQQRNRKRRRELATLIKRFRSGAESLPDAVVMMTEDGNIFWCNRHAQNLLGFRWPDDNGQHIFNLLRYPDFSRYLTHGDFSLPLTLELNNGTMVELRIMPYAEGQILMVARDVTEKRRLENSRRDFFANVSHELRTPLTVLQGYLEMLADQDFDNPMNKKAIITMQAQTRRMDGMVKQLLQLSKIEVAVKTEFDQPADIPGMLMMLQQEAQTLSHGLHDIRFDTDEKLKIFGDEDELRSAMSNLVYNAVNHTPEHTRIDVSWAVRNGNAVFSVKDNGPGIPAEHLSRLTERFYRVDKSRSRQTGGSGLGLAIVKHALQHHHSHLDIVSKPGQGAEFSFTIPAKFIVKSSH

Flanking regions ( +/- flanking 50bp)

GTTACCGTTTTTCCGTGCGTTACTGATTATAAACCGCAAGAGGATTGCGCGTGCTAGAGCGTCTTTCGTGGAAAAAAATTGTGCTGGAATTACTGGTTTTCTGCCTGCCGGCACTTATTTTGTCGCTTTTTTTCGGATTTACCGGTTGGTTTCTTGCCGCAGCGTTATTTGCGGTAACACTCTGGCATGGATATAACTTACTGAAATTATCGGACTGGCTGTGGCTGGATCGCAGTGTGTTGCCACCGCCCGGACGTAGCAGCTGGGAGCCGATTTTTTACGGTATTTATCAGCTGCAGCAACGTAACCGCAAGCGCCGCCGGGAACTCGCCACATTAATTAAACGTTTTCGCAGTGGTGCAGAATCGCTGCCTGATGCGGTAGTGATGATGACAGAAGACGGCAATATCTTCTGGTGTAACCGTCATGCTCAGAATTTATTAGGTTTCCGCTGGCCGGATGATAACGGGCAGCACATCTTTAACCTCCTGCGTTATCCGGATTTCAGCCGTTACCTTACACACGGTGATTTTTCCCTGCCGCTGACCCTGGAACTGAATAACGGCACCATGGTGGAGCTGCGCATCATGCCGTATGCTGAGGGACAGATACTGATGGTGGCGCGTGATGTAACAGAAAAACGCCGCCTCGAAAATTCCCGCCGTGACTTTTTTGCCAATGTCAGCCATGAGTTGCGCACTCCGCTGACTGTTTTACAGGGCTATCTTGAGATGCTGGCTGATCAGGATTTTGATAACCCGATGAATAAAAAGGCCATTATAACCATGCAGGCACAAACCCGCCGTATGGACGGAATGGTGAAGCAGTTATTGCAGTTGTCAAAAATTGAGGTGGCGGTTAAAACAGAGTTTGATCAGCCTGCAGATATTCCCGGAATGCTGATGATGCTGCAACAGGAAGCGCAGACGCTGAGTCACGGACTGCATGATATCCGCTTTGATACAGATGAAAAACTGAAGATTTTCGGTGATGAGGATGAACTGCGCAGCGCCATGTCGAATCTGGTGTATAACGCCGTGAATCATACTCCGGAGCATACCCGGATTGATGTCAGCTGGGCGGTACGTAACGGAAATGCTGTTTTCAGTGTTAAAGATAATGGTCCGGGAATTCCGGCGGAGCATTTGTCCCGTCTGACAGAACGTTTTTACCGGGTGGATAAATCCCGTTCCCGGCAGACCGGCGGTTCGGGGCTGGGGCTGGCGATTGTCAAACATGCGTTACAGCATCATCACAGCCATCTGGATATTGTCAGTAAACCCGGACAGGGTGCGGAGTTCAGTTTTACTATCCCGGCTAAATTTATCGTTAAATCCTCTCACTGAAAGCGGCTCCGGCCGTTTAGTGCTGTAATTGGTGTAATATTCAGCATATA