Homologs in group_21

Help

18 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08075 FBDBKF_08075 94.4 Morganella morganii S1 dmsB DMSO/selenate family reductase complex B subunit
FBDBKF_10455 FBDBKF_10455 48.3 Morganella morganii S1 dmsB DMSO/selenate family reductase complex B subunit
EHELCC_13905 EHELCC_13905 94.4 Morganella morganii S2 dmsB DMSO/selenate family reductase complex B subunit
EHELCC_14790 EHELCC_14790 48.3 Morganella morganii S2 dmsB DMSO/selenate family reductase complex B subunit
NLDBIP_14350 NLDBIP_14350 94.4 Morganella morganii S4 dmsB DMSO/selenate family reductase complex B subunit
NLDBIP_14620 NLDBIP_14620 48.3 Morganella morganii S4 dmsB DMSO/selenate family reductase complex B subunit
LHKJJB_08500 LHKJJB_08500 94.4 Morganella morganii S3 dmsB DMSO/selenate family reductase complex B subunit
LHKJJB_14725 LHKJJB_14725 48.3 Morganella morganii S3 dmsB DMSO/selenate family reductase complex B subunit
HKOGLL_08050 HKOGLL_08050 94.4 Morganella morganii S5 dmsB DMSO/selenate family reductase complex B subunit
HKOGLL_13345 HKOGLL_13345 48.3 Morganella morganii S5 dmsB DMSO/selenate family reductase complex B subunit
F4V73_RS05065 F4V73_RS05065 69.9 Morganella psychrotolerans - DMSO/selenate family reductase complex B subunit
F4V73_RS14155 F4V73_RS14155 48.3 Morganella psychrotolerans - DMSO/selenate family reductase complex B subunit
PMI_RS00325 PMI_RS00325 33.0 Proteus mirabilis HI4320 - 4Fe-4S dicluster domain-containing protein
PMI_RS00340 PMI_RS00340 33.3 Proteus mirabilis HI4320 - ferredoxin-like protein
PMI_RS00820 PMI_RS00820 43.0 Proteus mirabilis HI4320 - 4Fe-4S dicluster domain-containing protein
PMI_RS05815 PMI_RS05815 70.3 Proteus mirabilis HI4320 dmsB dimethylsulfoxide reductase subunit B
PMI_RS08350 PMI_RS08350 50.7 Proteus mirabilis HI4320 dmsB dimethylsulfoxide reductase subunit B
PMI_RS14660 PMI_RS14660 86.4 Proteus mirabilis HI4320 dmsB dimethylsulfoxide reductase subunit B

Distribution of the homologs in the orthogroup group_21

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_21

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P18776 6.08e-69 212 53 2 189 1 dmsB Anaerobic dimethyl sulfoxide reductase chain B Escherichia coli (strain K12)
Q83RZ7 6.7e-69 212 53 2 189 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Shigella flexneri
P0AAJ1 1.01e-68 212 53 2 189 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli (strain K12)
P0AAJ2 1.01e-68 212 53 2 189 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45003 1.16e-66 206 50 1 191 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
D3RNN7 7.36e-29 111 36 3 168 1 soeB Sulfite dehydrogenase subunit B Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
P44450 1.3e-28 112 34 3 166 3 fdxH Formate dehydrogenase iron-sulfur subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A1I1 2.17e-27 105 40 5 151 1 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1I2 2.17e-27 105 40 5 151 3 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhi
P0AAJ7 3.32e-26 105 32 3 167 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Shigella flexneri
P0AAJ5 3.32e-26 105 32 3 167 1 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli (strain K12)
P0AAJ6 3.32e-26 105 32 3 167 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAJ4 8.47e-26 104 32 3 164 3 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Shigella flexneri
P0AAJ3 8.47e-26 104 32 3 164 1 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Escherichia coli (strain K12)
P31076 4.53e-25 100 36 6 187 4 psrB Polysulfide reductase chain B Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q7CQM9 6.12e-25 101 34 5 181 1 ttrB Tetrathionate reductase subunit B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9HR73 1.43e-24 100 33 5 178 2 dmsB Putative dimethyl sulfoxide reductase iron-sulfur subunit B Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
P27273 8.35e-24 97 33 5 183 1 fdhB1 Formate dehydrogenase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
O30080 2.8e-23 95 35 5 157 3 ttrB Tetrathionate reductase subunit B Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q727P4 3.43e-23 95 32 4 176 1 DVU_2811 Formate dehydrogenase 2 subunit beta (cytochrome c-553) Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q47CW7 2.57e-22 95 28 7 266 1 pcrB Perchlorate reductase subunit beta Dechloromonas aromatica (strain RCB)
P0AAK9 4.35e-22 93 35 3 165 3 nrfC Protein NrfC Shigella flexneri
P0AAK7 4.35e-22 93 35 3 165 3 nrfC Protein NrfC Escherichia coli (strain K12)
P0AAK8 4.35e-22 93 35 3 165 3 nrfC Protein NrfC Escherichia coli O157:H7
P77375 5.04e-21 90 36 6 161 2 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli (strain K12)
Q8X616 1.24e-20 89 36 6 161 3 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli O157:H7
Q7WTT9 2.68e-20 88 29 5 212 1 arrB Arsenate respiratory reductase iron-sulfur subunit ArrB Shewanella sp. (strain ANA-3)
P0AAK0 6.86e-20 89 33 5 177 3 hybA Hydrogenase-2 operon protein HybA Shigella flexneri
P0AAJ8 6.86e-20 89 33 5 177 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli (strain K12)
P0AAJ9 6.86e-20 89 33 5 177 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli O157:H7
Q9S1G9 2.86e-19 87 26 7 276 1 serB Selenate reductase subunit beta Thauera selenatis
P45015 6.36e-19 84 33 4 158 3 nrfC Protein NrfC homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P60069 1.8e-17 82 26 7 276 1 clrB Chlorate reductase subunit beta Ideonella dechloratans
P0AAL8 3.5e-16 77 32 4 145 4 ydhY Uncharacterized ferredoxin-like protein YdhY Shigella flexneri
P0AAL6 3.5e-16 77 32 4 145 2 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli (strain K12)
P0AAL7 3.5e-16 77 32 4 145 4 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli O157:H7
Q83RN5 5.79e-16 79 39 1 99 3 narH Respiratory nitrate reductase 1 beta chain Shigella flexneri
P11349 5.96e-16 79 39 1 99 1 narH Respiratory nitrate reductase 1 beta chain Escherichia coli (strain K12)
Q8GC87 8.36e-16 76 27 3 169 1 fdhB Formate dehydrogenase subunit beta Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759)
P19318 8.5e-16 78 39 1 99 1 narY Respiratory nitrate reductase 2 beta chain Escherichia coli (strain K12)
P42176 4.02e-15 76 38 1 99 3 narH Nitrate reductase beta chain Bacillus subtilis (strain 168)
Q8GPG3 4.91e-15 75 25 6 234 1 ddhB Dimethylsulfide dehydrogenase subunit beta Rhodovulum sulfidophilum
I3R9M8 5.58e-15 75 26 8 257 1 narH Respiratory nitrate reductase subunit beta Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
Q46819 7.72e-14 69 27 5 159 4 ygfS Putative electron transport protein YgfS Escherichia coli (strain K12)
P33389 1.81e-13 71 30 4 168 4 DVU_0535 Protein DVU_0535 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q72E85 4.68e-13 69 30 7 194 1 qrcC Menaquinone reductase, iron-sulfur cluster-binding subunit Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
O29751 4.75e-13 69 28 10 218 1 hmeA Hdr-like menaquinol oxidoreductase iron-sulfur subunit 1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P56256 1.61e-12 66 25 6 175 4 ysaA Putative electron transport protein YsaA Escherichia coli (strain K12)
Q8L3A9 2.09e-12 68 29 4 147 1 padI NADH-dependent phenylglyoxylate dehydrogenase subunit beta Aromatoleum evansii
Q46820 2.98e-12 68 28 9 205 2 uacF Putative oxidoreductase UacF Escherichia coli (strain K12)
P31894 4.21e-12 65 27 6 177 1 cooF Iron-sulfur protein Rhodospirillum rubrum
Q57713 7.25e-12 64 31 4 125 3 MJ0265 Uncharacterized ferredoxin MJ0265 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P85098 1.36e-11 65 31 4 144 1 narH Respiratory nitrate reductase beta chain (Fragments) Bradyrhizobium sp.
P37127 2.48e-11 65 27 5 156 2 aegA Putative oxidoreductase AegA Escherichia coli (strain K12)
P0AAK4 4.74e-09 57 24 6 184 3 hydN Electron transport protein HydN Escherichia coli (strain K12)
P0AAK5 4.74e-09 57 24 6 184 3 hydN Electron transport protein HydN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAK6 4.74e-09 57 24 6 184 3 hydN Electron transport protein HydN Escherichia coli O157:H7
P20925 1.22e-08 55 31 5 109 4 None Frd operon probable iron-sulfur subunit A (Fragment) Proteus vulgaris
Q57712 1.9e-08 55 34 3 98 3 MJ0264 Uncharacterized protein MJ0264 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P80564 1.74e-07 53 27 6 166 1 bthL Pyrogallol hydroxytransferase small subunit Pelobacter acidigallici
Q57619 3.39e-07 51 31 3 91 3 MJ0155 Uncharacterized ferredoxin MJ0155 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P23481 5e-07 52 27 2 102 2 hyfA Hydrogenase-4 component A Escherichia coli (strain K12)
P0AAK3 7.66e-06 48 23 7 208 3 hycB Formate hydrogenlyase subunit 2 Shigella flexneri
P0AAK1 7.66e-06 48 23 7 208 1 hycB Formate hydrogenlyase subunit 2 Escherichia coli (strain K12)
P0AAK2 7.66e-06 48 23 7 208 3 hycB Formate hydrogenlyase subunit 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q92G41 1.12e-05 46 35 2 65 3 fdxA Ferredoxin Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q1RH11 2.81e-05 45 33 2 66 3 fdxA Ferredoxin Rickettsia bellii (strain RML369-C)
P00195 4.37e-05 43 40 2 57 1 None Ferredoxin Clostridium pasteurianum
O27719 5.53e-05 46 34 1 70 4 MTH_1684 Uncharacterized protein MTH_1684 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
P00194 6.21e-05 42 42 2 56 1 None Ferredoxin-1 Rhodospirillum rubrum
Q9ZCC8 0.000106 43 31 2 66 3 fdxA Ferredoxin Rickettsia prowazekii (strain Madrid E)
Q68Y04 0.000112 43 31 2 66 3 fdxA Ferredoxin Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q57934 0.000175 44 37 2 79 4 MJ0514 Uncharacterized polyferredoxin-like protein MJ0514 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q4UJX3 0.000211 42 31 2 66 3 fdxA Ferredoxin Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q50784 0.00023 45 37 2 62 4 mvhB Polyferredoxin protein MvhB Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
P60232 0.000295 44 37 2 62 1 mvhB Polyferredoxin protein MvhB Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q45972 0.000376 42 31 2 67 3 fdxA Ferredoxin-1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P00202 0.000467 40 47 0 40 1 None Ferredoxin Methanosarcina barkeri
Q44037 0.000503 41 32 2 65 4 fdxA Ferredoxin-1 (Fragment) Afipia felis
Q45560 0.000721 40 37 1 56 1 fdxA Ferredoxin 7Fe Hydrogenibacillus schlegelii
Q57652 0.000761 40 43 1 46 3 MJ0199 Uncharacterized ferredoxin MJ0199 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O58412 0.000815 41 44 1 49 3 vorD Ketoisovalerate oxidoreductase subunit VorD Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9UYZ0 0.000856 40 44 1 49 3 vorD Ketoisovalerate oxidoreductase subunit VorD Pyrococcus abyssi (strain GE5 / Orsay)
Q6LWL2 0.001 43 45 2 53 1 hdrA H(2)/formate:CoB-CoM heterodisulfide,ferredoxin reductase subunit A Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS12920
Feature type CDS
Gene -
Product DMSO/selenate family reductase complex B subunit
Location 190347 - 190991 (strand: -1)
Length 645 (nucleotides) / 214 (amino acids)

Contig

Accession term accessions NZ_VXKB01000003 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_21
Orthogroup size 19
N. genomes 7

Actions

Genomic region

Domains

PF12800 4Fe-4S binding domain
PF13247 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0437 Energy production and conversion (C) C Fe-S-cluster-containing dehydrogenase component (DMSO reductase)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07307 anaerobic dimethyl sulfoxide reductase subunit B Sulfur metabolism
Metabolic pathways		 -

Protein Sequence

MSKFIIYPAVSEKQLGFYIDSARCSGCKACQVACKDKNNLDVGRRFRRVYEMTGGGYSRNNNGALINNVFAYTLSISCNHCKDPICVRNCPTTAMHKREGDGIVMVNTDKCVGCGACAWSCPYGAPQMNPETKQMSKCDFCIDLQQKGEQPVCVSTCPLGAIQFGPIDELRAKYGNLDYVTGLPDPSITQPNLVINAHHGARFDDINSERKENE

Flanking regions ( +/- flanking 50bp)

CTGGCTCACGGTAATGCGCACCAGACACTATTAGTTGAGGTGGAAAAAGCATGAGTAAATTCATTATTTATCCGGCAGTCAGTGAAAAACAGTTAGGGTTTTATATTGATTCAGCCCGCTGCTCCGGCTGCAAAGCCTGTCAGGTTGCCTGTAAAGATAAAAACAATTTAGATGTCGGACGCCGTTTCCGCCGGGTGTATGAAATGACCGGCGGTGGTTACAGCCGTAACAATAATGGTGCGTTGATCAACAATGTGTTTGCTTACACGCTCTCCATTTCCTGTAACCACTGCAAAGACCCTATTTGTGTCCGCAACTGCCCGACGACAGCAATGCACAAGCGCGAAGGCGACGGCATAGTGATGGTCAATACAGACAAATGTGTCGGCTGTGGTGCCTGTGCGTGGTCATGTCCGTATGGTGCGCCGCAGATGAACCCGGAAACCAAACAGATGTCGAAATGCGATTTTTGCATTGATTTACAACAAAAAGGTGAGCAGCCGGTGTGTGTCAGCACGTGTCCGCTGGGCGCGATTCAGTTCGGACCGATTGATGAGTTGCGGGCGAAATACGGCAATCTGGATTATGTAACCGGTCTGCCTGATCCGTCCATTACACAGCCAAACCTGGTGATCAATGCGCATCACGGGGCACGTTTTGATGACATAAACAGTGAGAGAAAAGAAAATGAATGAGTGGTCGCTTTTAATTTTCACTTACATGATGAATGCGGCGGTGGGGTTGT