Homologs in group_1996

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15025 FBDBKF_15025 92.0 Morganella morganii S1 hemW radical SAM family heme chaperone HemW
EHELCC_11220 EHELCC_11220 92.0 Morganella morganii S2 hemW radical SAM family heme chaperone HemW
NLDBIP_11565 NLDBIP_11565 92.0 Morganella morganii S4 hemW radical SAM family heme chaperone HemW
LHKJJB_11425 LHKJJB_11425 92.0 Morganella morganii S3 hemW radical SAM family heme chaperone HemW
HKOGLL_10035 HKOGLL_10035 92.0 Morganella morganii S5 hemW radical SAM family heme chaperone HemW
PMI_RS01585 PMI_RS01585 79.8 Proteus mirabilis HI4320 hemW radical SAM family heme chaperone HemW

Distribution of the homologs in the orthogroup group_1996

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1996

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P52062 0.0 634 79 0 376 1 hemW Heme chaperone HemW Escherichia coli (strain K12)
P43899 0.0 528 66 1 369 3 hemW Heme chaperone HemW Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8K928 8.61e-134 390 46 1 376 3 hemW Heme chaperone HemW Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57615 4.01e-133 388 45 1 376 3 hemW Heme chaperone HemW Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89A47 1.43e-106 320 38 0 373 3 hemW Putative heme chaperone HemW-like protein Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P54304 2.29e-56 191 32 8 385 2 hemW Heme chaperone HemW Bacillus subtilis (strain 168)
Q9CGF7 4.76e-53 183 33 3 271 1 hemW Heme chaperone HemW Lactococcus lactis subsp. lactis (strain IL1403)
Q5SUV1 1.4e-52 183 38 3 270 2 Rsad1 Radical S-adenosyl methionine domain-containing protein 1, mitochondrial Mus musculus
P73245 3.86e-52 181 36 5 294 1 hemW Heme chaperone HemW Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P9WP73 3.6e-51 178 36 3 291 1 hemW Heme chaperone HemW Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WP72 3.6e-51 178 36 3 291 3 hemW Heme chaperone HemW Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5D7B1 6.86e-50 176 36 3 270 2 RSAD1 Radical S-adenosyl methionine domain-containing protein 1, mitochondrial Bos taurus
Q9HA92 1.07e-48 173 36 3 270 1 RSAD1 Radical S-adenosyl methionine domain-containing protein 1, mitochondrial Homo sapiens
A4IGH2 7.08e-47 168 33 4 293 2 rsad1 Radical S-adenosyl methionine domain-containing protein 1, mitochondrial Danio rerio
Q54VE8 6.11e-40 150 32 11 299 3 rsad1 Radical S-adenosyl methionine domain-containing protein 1, mitochondrial Dictyostelium discoideum
P32131 1.92e-30 124 31 2 243 1 hemN Oxygen-independent coproporphyrinogen III oxidase Escherichia coli (strain K12)
P0A1E1 6.87e-29 120 31 2 243 3 hemN Oxygen-independent coproporphyrinogen III oxidase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1E2 6.87e-29 120 31 2 243 3 None Oxygen-independent coproporphyrinogen III oxidase Salmonella typhi
O31381 3.73e-28 117 31 4 245 3 hemN Oxygen-independent coproporphyrinogen III oxidase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P95651 1.27e-27 116 26 10 352 3 hemN Oxygen-independent coproporphyrinogen III oxidase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
O67886 1.39e-27 116 30 4 250 3 hemN Oxygen-independent coproporphyrinogen III oxidase Aquifex aeolicus (strain VF5)
Q51676 2.5e-27 115 29 3 244 3 hemN Oxygen-independent coproporphyrinogen III oxidase Paracoccus denitrificans (strain Pd 1222)
Q796V8 3.95e-26 112 27 10 317 2 hemZ Oxygen-independent coproporphyrinogen-III oxidase-like protein HemZ Bacillus subtilis (strain 168)
P74132 9.23e-26 111 29 3 246 1 hemN Oxygen-independent coproporphyrinogen III oxidase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P33770 1.05e-24 108 25 9 367 3 hemN Coproporphyrinogen III oxidase, anaerobic 1 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
O34162 1.85e-24 107 30 6 300 2 hemN Oxygen-independent coproporphyrinogen III oxidase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P51008 1.09e-23 105 25 10 399 3 hemZ Oxygen-independent coproporphyrinogen III oxidase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A0A384LP51 1.13e-22 102 26 4 297 1 chuW Anaerobilin synthase Escherichia coli O157:H7
P77915 5.93e-22 100 31 2 192 2 hemN Oxygen-independent coproporphyrinogen III oxidase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O25376 9.39e-20 94 28 2 191 3 hemN Oxygen-independent coproporphyrinogen III oxidase Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZLH0 9.93e-20 93 28 2 191 3 hemN Oxygen-independent coproporphyrinogen III oxidase Helicobacter pylori (strain J99 / ATCC 700824)
P95506 6.81e-12 66 34 0 97 3 hemN Oxygen-independent coproporphyrinogen III oxidase (Fragment) Mannheimia haemolytica
P55477 3.24e-11 66 26 1 173 4 NGR_a03400 Uncharacterized protein y4hJ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
O31067 3.56e-10 64 26 1 158 3 hemN Oxygen-independent coproporphyrinogen III oxidase (Fragment) Thermostichus vulcanus

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS12425
Feature type CDS
Gene hemW
Product radical SAM family heme chaperone HemW
Location 68289 - 69419 (strand: 1)
Length 1131 (nucleotides) / 376 (amino acids)

Contig

Accession term accessions NZ_VXKB01000003 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1996
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04055 Radical SAM superfamily
PF06969 HemN C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0635 Coenzyme transport and metabolism (H) H Coproporphyrinogen-III oxidase HemN (oxygen-independent) or related Fe-S oxidoreductase

Kegg Ortholog Annotation(s)

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG013626 radical SAM family heme chaperone HemW VF0758 Nutritional/Metabolic factor

Protein Sequence

MDKLPPLSLYIHIPWCVQKCPYCDFNSHALKGEVPHDDYVAHLLADLDADLPLVPGREIRTIFIGGGTPSLLSAEAMQNLMDGVRARIPVAADAEVTMEANPGTVEADRFSGYQRAGINRISIGVQSFGDDKLIRLGRIHDAGEAKRAARLAATLGLRSFNLDLMHGLPDQTLDEALNDLRQAIELSPPHLSWYQLTIEPNTGFGSRPPVLPDDDLLWDIFSGGHQLLTQAGYVQYETSAYAKPGFQCQHNLNYWRFGDYLGIGCGAHGKISFDDGRILRTVKTKHPRGYMGGRYMDKQHDVEQDDRPFEFFMNRFRLLETMPRSDFTNYTGLPESVIRPQLDAALAAGEIRETQTHWQITEHGKLFLNTLLERFL

Flanking regions ( +/- flanking 50bp)

AATATCTCACCGCGGCCATGCGCTGACACTGCTGCTGGAAGCCCTGCGCAATGGATAAGCTTCCTCCGCTCAGTCTGTATATCCATATTCCGTGGTGTGTTCAGAAGTGTCCGTACTGTGATTTCAACTCTCACGCGCTTAAAGGTGAGGTGCCGCATGATGATTATGTGGCACACCTGCTGGCGGATTTAGATGCTGACCTGCCCCTGGTTCCCGGGCGGGAGATCCGCACTATTTTTATCGGCGGAGGCACACCCAGCCTGCTGAGTGCAGAGGCAATGCAAAACCTGATGGACGGCGTACGTGCGCGAATTCCGGTTGCCGCAGATGCAGAAGTGACAATGGAAGCCAATCCGGGTACGGTCGAAGCGGATCGCTTCAGTGGCTATCAGCGCGCCGGTATCAACCGGATTTCGATTGGCGTGCAGAGCTTCGGCGATGACAAACTTATCCGCCTGGGACGTATTCATGATGCAGGTGAAGCCAAACGGGCGGCACGGCTGGCGGCGACACTCGGGCTTCGCAGCTTTAACCTCGATCTGATGCACGGCCTGCCGGATCAGACTCTGGATGAAGCACTGAATGACCTGCGACAGGCAATCGAATTATCCCCGCCGCACCTGTCCTGGTATCAGCTGACGATTGAACCGAACACCGGCTTCGGCTCCCGCCCGCCGGTTCTGCCGGATGACGACCTGCTGTGGGATATCTTCTCCGGGGGACATCAGTTACTGACACAGGCAGGCTATGTGCAGTATGAAACCTCCGCTTATGCAAAGCCGGGCTTTCAGTGTCAGCACAATCTCAATTACTGGCGTTTCGGGGATTATCTGGGCATCGGCTGCGGCGCACACGGTAAGATTTCATTTGACGACGGGCGCATTCTGCGGACAGTCAAAACCAAACACCCGCGCGGCTATATGGGCGGGCGCTATATGGATAAACAGCATGACGTGGAGCAGGACGATCGTCCGTTTGAGTTCTTTATGAACCGCTTCCGGCTGCTGGAAACGATGCCGCGCAGTGATTTCACCAATTATACCGGTCTGCCTGAATCCGTGATCCGCCCGCAGCTTGATGCAGCTCTGGCGGCAGGTGAAATCAGGGAAACGCAAACGCACTGGCAAATTACCGAACACGGAAAGTTATTCCTCAATACCTTACTTGAGCGTTTTTTATAACCGCTTTTATAATAAAGAAAACCCGGTGGCTATTCACATAACCACCGGGC