Homologs in group_1996

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15025 FBDBKF_15025 79.8 Morganella morganii S1 hemW radical SAM family heme chaperone HemW
EHELCC_11220 EHELCC_11220 79.8 Morganella morganii S2 hemW radical SAM family heme chaperone HemW
NLDBIP_11565 NLDBIP_11565 79.8 Morganella morganii S4 hemW radical SAM family heme chaperone HemW
LHKJJB_11425 LHKJJB_11425 79.8 Morganella morganii S3 hemW radical SAM family heme chaperone HemW
HKOGLL_10035 HKOGLL_10035 79.8 Morganella morganii S5 hemW radical SAM family heme chaperone HemW
F4V73_RS12425 F4V73_RS12425 79.8 Morganella psychrotolerans hemW radical SAM family heme chaperone HemW

Distribution of the homologs in the orthogroup group_1996

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1996

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P52062 0.0 606 75 0 376 1 hemW Heme chaperone HemW Escherichia coli (strain K12)
P43899 0.0 530 67 1 369 3 hemW Heme chaperone HemW Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8K928 9.24e-141 407 48 1 376 3 hemW Heme chaperone HemW Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57615 5.29e-138 400 47 1 376 3 hemW Heme chaperone HemW Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89A47 4.25e-106 319 40 2 376 3 hemW Putative heme chaperone HemW-like protein Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P54304 3.19e-58 196 31 8 382 2 hemW Heme chaperone HemW Bacillus subtilis (strain 168)
P73245 3.43e-57 194 38 10 314 1 hemW Heme chaperone HemW Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P9WP73 1.19e-56 192 32 7 382 1 hemW Heme chaperone HemW Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WP72 1.19e-56 192 32 7 382 3 hemW Heme chaperone HemW Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q5SUV1 2.99e-55 190 38 3 270 2 Rsad1 Radical S-adenosyl methionine domain-containing protein 1, mitochondrial Mus musculus
Q9CGF7 1.6e-54 187 34 3 271 1 hemW Heme chaperone HemW Lactococcus lactis subsp. lactis (strain IL1403)
A5D7B1 8.63e-54 186 37 3 270 2 RSAD1 Radical S-adenosyl methionine domain-containing protein 1, mitochondrial Bos taurus
Q9HA92 4.36e-51 179 36 3 270 1 RSAD1 Radical S-adenosyl methionine domain-containing protein 1, mitochondrial Homo sapiens
A4IGH2 1.17e-49 176 33 3 283 2 rsad1 Radical S-adenosyl methionine domain-containing protein 1, mitochondrial Danio rerio
Q54VE8 1.32e-39 149 32 10 298 3 rsad1 Radical S-adenosyl methionine domain-containing protein 1, mitochondrial Dictyostelium discoideum
Q796V8 1.49e-29 122 29 10 311 2 hemZ Oxygen-independent coproporphyrinogen-III oxidase-like protein HemZ Bacillus subtilis (strain 168)
O31381 1.3e-27 116 27 2 241 3 hemN Oxygen-independent coproporphyrinogen III oxidase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P32131 1.67e-27 116 29 1 242 1 hemN Oxygen-independent coproporphyrinogen III oxidase Escherichia coli (strain K12)
Q51676 3.92e-27 115 28 2 242 3 hemN Oxygen-independent coproporphyrinogen III oxidase Paracoccus denitrificans (strain Pd 1222)
P0A1E1 4.29e-27 115 29 1 242 3 hemN Oxygen-independent coproporphyrinogen III oxidase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1E2 4.29e-27 115 29 1 242 3 None Oxygen-independent coproporphyrinogen III oxidase Salmonella typhi
O67886 1.39e-26 113 29 5 247 3 hemN Oxygen-independent coproporphyrinogen III oxidase Aquifex aeolicus (strain VF5)
P95651 5.15e-26 111 26 11 372 3 hemN Oxygen-independent coproporphyrinogen III oxidase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
O34162 6.7e-26 112 28 6 298 2 hemN Oxygen-independent coproporphyrinogen III oxidase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A0A384LP51 6.69e-25 108 28 4 285 1 chuW Anaerobilin synthase Escherichia coli O157:H7
P77915 5.26e-24 106 29 4 236 2 hemN Oxygen-independent coproporphyrinogen III oxidase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P33770 1.92e-22 101 28 1 190 3 hemN Coproporphyrinogen III oxidase, anaerobic 1 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
P74132 2.53e-21 98 29 2 203 1 hemN Oxygen-independent coproporphyrinogen III oxidase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P51008 5.39e-21 97 24 8 337 3 hemZ Oxygen-independent coproporphyrinogen III oxidase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q9ZLH0 1.21e-20 96 30 4 197 3 hemN Oxygen-independent coproporphyrinogen III oxidase Helicobacter pylori (strain J99 / ATCC 700824)
O25376 1.44e-20 96 30 4 203 3 hemN Oxygen-independent coproporphyrinogen III oxidase Helicobacter pylori (strain ATCC 700392 / 26695)
P55477 3.06e-12 69 26 3 175 4 NGR_a03400 Uncharacterized protein y4hJ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
O31067 1.22e-10 65 25 1 158 3 hemN Oxygen-independent coproporphyrinogen III oxidase (Fragment) Thermostichus vulcanus
P95506 2.22e-09 58 31 0 97 3 hemN Oxygen-independent coproporphyrinogen III oxidase (Fragment) Mannheimia haemolytica

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01585
Feature type CDS
Gene hemW
Product radical SAM family heme chaperone HemW
Location 382997 - 384127 (strand: -1)
Length 1131 (nucleotides) / 376 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1996
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04055 Radical SAM superfamily
PF06969 HemN C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0635 Coenzyme transport and metabolism (H) H Coproporphyrinogen-III oxidase HemN (oxygen-independent) or related Fe-S oxidoreductase

Kegg Ortholog Annotation(s)

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG013626 radical SAM family heme chaperone HemW VF0758 Nutritional/Metabolic factor

Protein Sequence

MLKLPPLSLYIHIPWCVQKCPYCDFNSHTLKGEVPHQEYVQHLLNDLDADLTHVGSREVQTIFIGGGTPSLLSAESMADLLYGVKERIAVAPDAEITMEANPGTVEAERFAGFQRAGINRISIGVQSFGNDKLIRLGRIHDADEAKNAARLAKELGLRSFNLDLMHGLPDQSLSQALSDLQQAIALSPPHLSWYQLTIEPNTQFGSRPPKLPDDDMLWDIFSEGDKLLTAAGYQQYETSAYCKPGFQCQHNLNYWRFGDYLGIGCGAHGKISFADGRIMRTVKTKHPKGFMAGRYLHQQNWVDNDDRPFEFFMNRFRLLEAFPRQDFSDYTGLAQETIRRQIDEALALGYISETETHWQITPHGKLFLNSLLELFL

Flanking regions ( +/- flanking 50bp)

ATACTCTCACCGTGGTAAAGCACTAAAACTAATGTTGGATGCACTTAAGAATGCTTAAGTTACCACCATTAAGTTTGTATATTCATATTCCTTGGTGTGTACAAAAATGCCCTTATTGTGATTTTAATTCTCACACCTTAAAAGGCGAAGTTCCACATCAGGAATATGTGCAACATCTGCTCAATGATTTAGATGCTGATCTTACTCATGTTGGCTCTCGTGAAGTGCAAACTATCTTTATTGGTGGTGGCACGCCAAGCCTATTAAGTGCTGAATCAATGGCTGATTTACTGTATGGCGTAAAAGAGCGCATAGCCGTTGCTCCTGATGCTGAAATTACGATGGAAGCCAATCCTGGTACGGTTGAAGCTGAACGATTTGCCGGTTTTCAACGGGCGGGAATTAACCGTATATCCATTGGTGTACAAAGCTTTGGTAATGATAAACTGATCCGCTTAGGACGCATTCATGATGCCGATGAAGCTAAAAATGCCGCGAGACTAGCAAAAGAGTTAGGCTTACGTAGCTTTAATCTTGATTTAATGCATGGCTTACCTGACCAATCATTATCTCAAGCACTTTCAGATCTACAACAAGCAATCGCTTTATCTCCCCCACATCTTTCTTGGTATCAATTAACTATTGAACCCAATACGCAATTTGGCTCCCGTCCGCCTAAATTACCTGATGATGATATGTTATGGGATATTTTTTCTGAAGGTGACAAATTACTCACCGCAGCAGGATATCAACAATATGAAACATCGGCTTATTGTAAGCCAGGTTTTCAATGTCAACATAACCTAAACTATTGGCGTTTTGGGGATTATTTAGGTATTGGCTGTGGTGCTCATGGAAAAATAAGTTTTGCCGATGGCCGAATTATGAGAACGGTAAAAACCAAACATCCTAAAGGTTTTATGGCAGGACGTTATCTTCACCAGCAAAATTGGGTTGATAATGATGACCGTCCATTTGAATTTTTTATGAACCGCTTTCGGTTATTAGAAGCTTTTCCTCGGCAAGATTTTAGCGACTACACGGGGCTTGCACAAGAGACTATCCGTAGGCAAATTGATGAAGCACTCGCATTAGGTTATATCAGTGAAACAGAAACCCATTGGCAGATAACGCCCCACGGTAAACTGTTTCTTAATTCATTACTTGAACTCTTTCTTTAATACGAAAATTCACTTATTTCGTTAATAAACAAATGCCCATACTGTTCATT