Homologs in group_1417

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08755 FBDBKF_08755 87.9 Morganella morganii S1 ubiT Ubiquinone biosynthesis accessory factor UbiT, lipid carrier SCP2 domain
EHELCC_12770 EHELCC_12770 87.9 Morganella morganii S2 ubiT Ubiquinone biosynthesis accessory factor UbiT, lipid carrier SCP2 domain
NLDBIP_13110 NLDBIP_13110 87.9 Morganella morganii S4 ubiT Ubiquinone biosynthesis accessory factor UbiT, lipid carrier SCP2 domain
LHKJJB_13445 LHKJJB_13445 87.9 Morganella morganii S3 ubiT Ubiquinone biosynthesis accessory factor UbiT, lipid carrier SCP2 domain
HKOGLL_11585 HKOGLL_11585 87.9 Morganella morganii S5 ubiT Ubiquinone biosynthesis accessory factor UbiT, lipid carrier SCP2 domain
PMI_RS17160 PMI_RS17160 65.3 Proteus mirabilis HI4320 - SCP2 domain-containing protein

Distribution of the homologs in the orthogroup group_1417

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1417

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P64599 4.24e-70 213 60 0 170 3 ubiT Ubiquinone biosynthesis accessory factor UbiT Escherichia coli (strain K12)
P64600 4.24e-70 213 60 0 170 3 ubiT Ubiquinone biosynthesis accessory factor UbiT Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P64601 4.24e-70 213 60 0 170 3 ubiT Ubiquinone biosynthesis accessory factor UbiT Escherichia coli O157:H7
Q07598 0.000391 43 29 1 65 2 SCP2 Sterol carrier protein 2 (Fragment) Gallus gallus
P07857 0.001 42 29 1 65 1 SCP2 Sterol carrier protein 2 Bos taurus

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS09970
Feature type CDS
Gene -
Product SCP2 domain-containing protein
Location 101316 - 101837 (strand: 1)
Length 522 (nucleotides) / 173 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1417
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02036 SCP-2 sterol transfer family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3154 Coenzyme transport and metabolism (H) H Ubiquinone biosynthesis accessory factor UbiT, lipid carrier SCP2 domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K24843 O2-independent ubiquinone biosynthesis accessory factor UbiT - -

Protein Sequence

MFAKIRSSLVQNGPALLRFPLKLTPFTLQKQVLQQVLARQFEEAMTEGDLDFLEDKWLKVEVRDMALCWFISNQNGRLVVSADEQEDVSFSGNANDLVLIAARKEDPDTLFFQRRLRIEGDTELGLYVKNLMDSIDLDAMPALLRSALMQLAEFIQAGMDAEAAQSHTAVPSC

Flanking regions ( +/- flanking 50bp)

GCAATCTTCTGGCACAATGACGCAGGAATTCAGATTAAGGAGTCAGTACGGTGTTTGCCAAAATTCGTTCCTCGCTCGTGCAAAACGGGCCTGCGTTATTGCGGTTTCCGCTGAAATTAACGCCGTTTACCCTGCAAAAACAGGTTCTTCAGCAAGTTCTGGCGCGTCAGTTTGAAGAGGCGATGACAGAAGGCGATCTCGATTTTCTGGAAGACAAGTGGCTGAAAGTGGAAGTCCGCGATATGGCGCTGTGCTGGTTTATCAGTAATCAGAATGGCCGGCTGGTGGTCAGTGCGGATGAGCAGGAAGATGTCAGCTTCAGTGGTAACGCCAATGATCTGGTACTGATTGCCGCCCGTAAAGAAGACCCGGATACCCTGTTTTTCCAGCGCCGCCTGCGTATTGAAGGTGATACTGAGCTGGGGTTGTATGTGAAGAATCTGATGGACTCAATTGATCTCGATGCGATGCCCGCGCTGCTGCGCAGTGCATTAATGCAACTGGCTGAATTTATTCAGGCGGGTATGGACGCGGAGGCCGCGCAATCACATACCGCGGTGCCGTCATGTTGATCCGCACAGAGATCCCGGTTGATGCCGCCGGTATTGATGCATTGCTGCGC