Homologs in group_1417

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08755 FBDBKF_08755 100.0 Morganella morganii S1 ubiT Ubiquinone biosynthesis accessory factor UbiT, lipid carrier SCP2 domain
EHELCC_12770 EHELCC_12770 100.0 Morganella morganii S2 ubiT Ubiquinone biosynthesis accessory factor UbiT, lipid carrier SCP2 domain
NLDBIP_13110 NLDBIP_13110 100.0 Morganella morganii S4 ubiT Ubiquinone biosynthesis accessory factor UbiT, lipid carrier SCP2 domain
LHKJJB_13445 LHKJJB_13445 100.0 Morganella morganii S3 ubiT Ubiquinone biosynthesis accessory factor UbiT, lipid carrier SCP2 domain
F4V73_RS09970 F4V73_RS09970 87.9 Morganella psychrotolerans - SCP2 domain-containing protein
PMI_RS17160 PMI_RS17160 67.1 Proteus mirabilis HI4320 - SCP2 domain-containing protein

Distribution of the homologs in the orthogroup group_1417

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1417

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P64599 1.07e-69 211 59 0 170 3 ubiT Ubiquinone biosynthesis accessory factor UbiT Escherichia coli (strain K12)
P64600 1.07e-69 211 59 0 170 3 ubiT Ubiquinone biosynthesis accessory factor UbiT Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P64601 1.07e-69 211 59 0 170 3 ubiT Ubiquinone biosynthesis accessory factor UbiT Escherichia coli O157:H7
Q07598 0.000747 42 29 0 61 2 SCP2 Sterol carrier protein 2 (Fragment) Gallus gallus

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_11585
Feature type CDS
Gene ubiT
Product Ubiquinone biosynthesis accessory factor UbiT, lipid carrier SCP2 domain
Location 29950 - 30471 (strand: -1)
Length 522 (nucleotides) / 173 (amino acids)

Contig

Accession ZDB_689
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1417
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02036 SCP-2 sterol transfer family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3154 Coenzyme transport and metabolism (H) H Ubiquinone biosynthesis accessory factor UbiT, lipid carrier SCP2 domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K24843 O2-independent ubiquinone biosynthesis accessory factor UbiT - -

Protein Sequence

MFAKIRSSLVHNGPALLRFPLKLTPFTLQKQVLQQVLARQFEEALTEGDLDFLENKWLKVEVRDLALHWYISNRDGRLVVSADEQEDVSFSGNANDLVLIAARKEDPDTLFFQRRLRIEGDTELGLYVKNLMDSIDLDGMPPLLRSALMQLAEFIQAGLAEDGDKSQAVVTSC

Flanking regions ( +/- flanking 50bp)

TGCAGATTCTGGCACAATGGCGCAGTAATTCAGATTAAGGAGTCAGTACGGTGTTTGCCAAAATTCGTTCCTCGCTCGTACACAACGGGCCGGCGTTATTGCGGTTCCCGCTGAAATTAACGCCGTTTACCCTGCAAAAACAGGTTCTTCAGCAGGTTCTGGCGCGTCAGTTTGAAGAGGCGCTGACAGAAGGCGATCTCGATTTTCTGGAAAATAAATGGCTGAAGGTGGAAGTCCGTGACCTGGCGCTTCACTGGTATATCAGTAACCGTGACGGCCGTCTGGTGGTCAGTGCGGATGAACAGGAGGATGTCAGCTTCAGCGGTAATGCTAATGATCTGGTGCTGATCGCGGCCCGCAAAGAGGACCCGGATACCCTGTTCTTCCAGCGCCGTCTGCGTATTGAAGGGGATACCGAGCTGGGTCTGTATGTCAAAAACCTGATGGACTCGATTGACCTCGACGGTATGCCGCCGCTGCTGCGCAGCGCATTAATGCAGCTGGCTGAGTTTATTCAGGCCGGGCTGGCGGAAGACGGGGATAAATCGCAGGCAGTGGTGACCTCATGCTGATCCGCACAGAAATTCCGGTTGATGCCGCCGGTATCGATGCACTGCTGCGC